Overview
Alternative Name Venom basic protease inhibitor 1 homolog, Toxin C13S2C3, α-DTX
Lyophilized Powder yes
Origin Natural peptide isolated from Dendroaspis angusticeps (Eastern green mamba).
MW: 7048 Da
Purity: >98% (HPLC)
Effective concentration 10-500 nM.
Sequence QPRRKLCILHRNPGRCYDKIPAFYYNQKKKQCERFDWSGCGGNSNRFKTIEECRRTCIG.
Modifications Disulfide bonds between Cys7-Cys57, Cys16-Cys40 and Cys32-Cys53. Gln1 – Pyrrolidone carboxylic acid.
Structure
Molecular formula C305H481N99O84S6.
CAS No.: 74504-53-3
Activity α-Dendrotoxin inhibits 4-AP sensitive, inactivating voltage-gated K+ channels (KV1.1, KV1.2 and KV1.6).
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to four weeks at 4°C or three months at -20°C.
Our bioassay
Alomone Labs α-Dendrotoxin inhibits KV1.1 and KV1.2 channel currents heterologously expressed in Xenopus oocytes.KV1.1 (left, in 2 mM K+) and KV1.2 (right, in 5 mM K+) channel currents elicited by 200 ms depolarization from a holding potential of -100 mV to +20 mV, before and during application of 100 nM α-Dendrotoxin (#D-350). 73% (n = 4) of the KV1.1 and 80% (n = 4) of the KV1.2 channels were inhibited by α-Dendrotoxin, respectively.
Scientific background
α-Dendrotoxin is isolated from Dendroaspis angusticeps snake venom by modification of the procedures of Harvey1 and Benishin2 and purified to homogeneity. α-Dendrotoxin blocks KV1.1 and KV1.2 channels (IC50= 0.4 to 4 and 1.1 to 12 nM in oocytes respectively, with higher values for mammalian cells).4 In addition, the toxin was shown to block KV1.6 (IC50= 9-25 nM).4
α-Dendrotoxin was recently found to block ASIC currents in rat dorsal root ganglia with IC50 in the nM range5.
Target KV1.1, KV1.2, KV1.6, ASIC channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 09/03/2025
Specifications
Citations
Citations
