δ-Dendrotoxin

Applications
Specifications
Scientific Background

Overview

Cat #: D-380

Purity: >98% (HPLC)

MW: 6568 Da

Form: Lyophilized

δ-Dendrotoxin (#D-380) is a highly pure, natural, and biologically active peptide toxin.

Certificate of Analysis SDS

Structure

For research purposes only, not for human use

Applications

Citations (6)

Citations

Product citations

Meneses, D. et al. (2015) Synapse. 69, 446.
Coulson, E.J. et al. (2008) J. Neurosci. 28, 315.
Guan, D. et al. (2006) J. Physiol. 571.2, 371.
Khavandgar, S. et al. (2005) J. Physiol. 569.2, 545.
Owen, D.G. et al. (1997) Br. J. Pharmacol. 120, 1029.
Southan, A.P. and Owen, D.G. (1997) Br. J. Pharmacol. 122, 335.

Specifications

Properties

Technical Specifications

Origin Natural peptide isolated from Dendroaspis angusticeps (Eastern green mamba).

MW 6568 Da

Sequence AAKYCKLPVRYGPCKKKIPSFYYKWKAKQCLPFDYSGCGGNANRFKTIEECRRTCVG.

Modifications Disulfide bonds between Cys⁵-Cys⁵⁵, Cys¹⁴-Cys³⁸ and Cys³⁰-Cys⁵¹.

Peptide Content 100%

Purity >98% (HPLC)

Molecular formula C₂₉₆H₄₅₈N₈₂O₇₆S₆.

Biological Activity

Target K_V1.1, K_V1.6 and K_ir1.1 K⁺ channels

Effective concentration 10-100 nM.

Activity δ-Dendrotoxin inhibits 4-AP sensitive, inactivating voltage-gated K⁺ channels (K_V1.1, K_V1.2 and K_V1.6). In addition δ-Dendrotoxin inhibits ROMK1 channel currents.

Solubility and Storage

Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).

Storage of solutions Up to four weeks at 4°C or three months at -20°C.

Scientific Background

References

Scientific background

δ-Dendrotoxin is isolated from Dendroaspis angusticeps¹ snake venom by modification of the procedures of Harvey² and Benishin¹ and purified to homogeneity.

δ-Dendrotoxin blocks K_V1.1 channels (IC₅₀= 0.1 nM,³ for review see 4). The toxin was shown to also block K_V1.6 (IC₅₀= 23 nM).⁴ In addition δ-Dendrotoxin blocks ROMK1 inward rectifier K⁺ channels with Kd of 150 nM.³