Overview
Alternative Name ω-Agatoxin IVB, Agatoxin IVB
Lyophilized Powder yes
Origin Synthetic peptide
MW: 5273 Da
Purity: >99% (HPLC)
Form Lyophilized powder.
Effective concentration 20 nM - 1 µM.
Sequence EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA.
Modifications Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36 and Cys27-Cys34. D-Ser46.
Structure
Molecular formula C215H337N65O70S10.
CAS No.: 158484-42-5
Activity ω-Agatoxin TK is an antagonist of voltage-sensitive P-type Ca2+ channels1.
References-Activity
- Teramoto, T. et al. (1993) Biochem. Biophys. Res. Commun. 196, 134.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Water, or 0.9% NaCl solution. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to one week at 4°C or three months at -20°C.
Our bioassay
Alomone Labs ω-Agatoxin TK inhibits CaV2.1 channels heterologously expressed in Xenopus oocytes.A. Time course of ω-Agatoxin TK (#STA-530) action on CaV2.1 currents. Maximum current amplitude was plotted as a function of time. Membrane potential was held at -100 mV and oocytes were stimulated by a 100 ms voltage ramp to +50 mV in the presence of 2 mM Ba2+. 1 µM ω-Agatoxin TK was perfused as indicated by the bar for 300 s (green). B. Superimposed example of CaV2.1 channel current in the absence (control) and presence (green) of 1 µM ω-Agatoxin TK (taken from the experiment in A).
Alomone Labs ω-Agatoxin TK inhibits P-type CaV2.1 channel currents heterologously expressed in HEK 293T cells.Cells were transiently transfected with the α1A, β3 and α2δ subunits. The currents were elicited by 40 ms voltage ramp from holding potential of -100 mV to +60 mV, applied every 10 sec using whole-cell voltage clamp technique. A. Superimposed traces of CaV2.1 currents under control conditions (black) and following 5 min perfusion with 200 nM ω-Agatoxin TK (green). B. Time course of CaV2.1 peak current amplitude change as a result of 200 nM toxin application (ω-Agatoxin TK perfusion is indicated by the horizontal bar).
Scientific background ω-Agatoxin TK is a peptide toxin originally isolated from Agelenopsis aperta spider venom. ω-Agatoxin TK was shown to be a selective and reversible blocker of CaV2.1 (P/Q type) channels1. Originally the toxin was designated ω-Agatoxin IVB5-8.
Target P-type and Q-type Ca2+ channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 07/05/2024
Specifications
Citations
Citations
