Overview
Alternative Name K+ channel toxin α-KTx 15.4, AaTX1
Lyophilized Powder yes
Origin Recombinant, E. coli
MW: 3868 Da
Purity: >98% (HPLC)
Effective concentration 100 nM - 1 µM.
Sequence QNETNKKCQGGSCASVCRRVIGVAAGKCINGRCVCYP.
Modifications Disulfide bonds between Cys8-Cys28, Cys13-Cys33, and Cys17-Cys35.
Structure
Molecular formula C156H266N54O49S6.
Activity Aa1 Toxin is a blocker of A-type voltage-gated transient K+ channels of cerebellar granular cells1,2.
References-Activity
- Pisciotta, M. et al. (1998) Biochem. Biophys. Res. Comm. 242, 287.
- Pisciotta, M. et al. (1998) Eur. Biophys. J. 27, 69.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to one week at 4°C or three months at -20°C.
Our bioassay
Alomone Labs Aa1 Toxin inhibits Shaker-B channels expressed in Xenopus oocytes.Left: Current responses to 100 ms depolarization to 0 mV from holding potential of -100 mV, delivered every 10 seconds before (red) and during (green) application of 1 µM Aa1 Toxin (#RTA-400). Right: Time course of amplitude inhibition.
Scientific background Native Aa1 was originally isolated from Androctonus australis scorpion venom. Aa1 blocks Shaker B channels expressed in Xenopus oocytes with IC50=4.5 µM.1 In addition, the Aa1 toxin was shown to block the fast (A-type) K+ current in cerebellum granular cells (IC 50 =134 nM,2 or Kd = 150 nM3). In both cases the block is non-voltage-dependent and does not affect kinetic parameters of the K+ currents.
Target KV1.3 K+ channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 07/05/2024
Specifications
Citations
Citations
