Overview
Alternative Name Neurotoxin-1, AaH I, AaHI, Neurotoxin I
Lyophilized Powder yes
Origin Synthetic peptide
MW: 6804 Da
Purity: >98% (HPLC)
Form Lyophilized powder.
Effective concentration 1 µM.
Sequence KRDGYIVYPNNCVYHCVPPCDGLCKKNGGSSGSCSFLVPSGLACWCKDLPDNVPIKDTSRKCT.
Modifications Disulfide bonds between Cys12-Cys62, Cys16-Cys34, Cys20-Cys44 and Cys24-Cys46.
Structure
Molecular formula C293H452N82O89S8
Activity AaH1 Toxin is a NaV channel activator. It blocks the fast inactivation of the channel1.
References-Activity
- Possani, L.D. et al. (1999) Eur. J. Biochem. 264, 287.
Accession number P01479.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
Alomone Labs AaH1 Toxin modulates NaV1.2 channels expressed in Xenopus oocytes.A. Representative time course of AaH1 Toxin (#STA-155) effect on the normalized area of NaV1.2 channel current. Membrane potential was held at -100 mV, current was elicited by a 100 ms voltage step to 0 mV every 10 sec and was significantly enhanced by the application of 1 µM AaH1 Toxin (green). B. Superimposed traces of NaV1.2 current after application of control (black) and of 1 µM AaH1 Toxin (green), taken from the recording in A.
Scientific background
AaH1 Toxin is a low molecular weight peptide toxin originally isolated from Androctonus australis scorpion venom. It blocks the fast inactivation phase of voltage-gated Na+ channels1-3. AaH1 Toxin is one of four α-toxins: AahI, AahII, AahIII, and AahIV which account for 95% of the venom lethality2.
There are nine mammalian subtypes of voltage-gated sodium (NaV) channels: NaV1.1–NaV1.9. They are responsible for propagating action potentials in excitable cells and are considered to be important therapeutic targets in numerous pathophysiological conditions such as cardiac arrhythmia and epilepsy4.
Target NaV channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 07/05/2024
Specifications
Citations
Citations
