Agitoxin-2

Applications
Specifications
Scientific Background

Overview

Cat #: STA-420

Purity: >98% (HPLC)

CAS No.: 168147-41-9

MW: 4091 Da

Form: Lyophilized

Agitoxin-2 (#STA-420) is a highly pure, synthetic, and biologically active peptide toxin.

Certificate of Analysis SDS

Alternative Name Potassium channel toxin α-KTx 3.2, AgTx-2, AgTx2, Agitoxin 2

Structure

For research purposes only, not for human use

Applications

Citations (15)

Citations

Product citations

Pless, S.A. et al. (2013) eLife. 2, e01289.
Huang, C.W. et al. (2011) Neuroscience 176, 431.
Menteyne, A. et al. (2009) PLoS ONE 4, e6770.
Takacs, Z. et al. (2009) Proc. Natl. Acad. Sci. U.S.A. 106, 22211.

Specifications

Properties

Technical Specifications

Origin Synthetic peptide

MW 4091 Da

Sequence GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK.

Modifications Disulfide bonds between Cys⁸-Cys²⁸, Cys¹⁴-Cys³³, and Cys¹⁸-Cys³⁵.

Peptide Content 100%

Purity >98% (HPLC)

Molecular formula C₁₆₉H₂₇₈N₅₄O₄₈S₈.

CAS No. 168147-41-9

Accession number P46111.

Biological Activity

Target K_V1.3 K⁺ channels

Effective concentration 50 pM - 10 nM.

Activity Agitoxin-2 is a blocker of Shaker voltage-gated K⁺ channels as well as the mammalian homologues of Shaker.

Solubility and Storage

Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).

Storage of solutions Up to two week at 4°C or three months at -20°C.

Scientific Background

References

Scientific background Native Agitoxin-2 was originally isolated from the venom of the Israeli scorpion L. quinquestriatus hebraeus.¹Agitoxin-2 inhibited the native K_V1.3-like current in cultured microglia by 72% at 5 nM and K_V1.3 in MLS-9 cells by 87%.²Agitoxin-2 is a potent blocker of the Shaker voltage-gated K⁺-channels as well as the mammalian homologues of Shaker.¹

References