Overview
|
Bioz Stars Product Rating | |
The world's only objective ratings for scientific research products | |
Mentions | |
Recency | |
View product page > |
Cat #:
STA-420
Purity: >98% (HPLC)
CAS No.: 168147-41-9
MW: 4091 Da
Form: Lyophilized
Agitoxin-2 (#STA-420) is a highly pure, synthetic, and biologically active peptide toxin.
Alternative Name Potassium channel toxin α-KTx 3.2, AgTx-2, AgTx2, Agitoxin 2
MW: 4091 Da
For research purposes only, not for human use
Applications
Our Bioassay
Our bioassay
- Alomone Labs Agitoxin-2 inhibits KV1.3 currents heterologously expressed in Xenopus oocytes.A. Time course of Agitoxin-2 (#STA-420) action on KV1.3 currents. Maximum current amplitudes at +50 mV were plotted as a function of time. Membrane potential was held at –80 mV and cells were stimulated by a 150 ms voltage ramp to +50 mV. 1 nM Agitoxin-2 was perfused as indicated by the bar (green) during 150 sec. B. Superimposed examples of KV1.3 channel current in the absence (control) and presence (green) of 1 nM Agitoxin-2 (taken from the experiment in A).
Citations (7)
Citations
Product citations
- Pless, S.A. et al. (2013) eLife. 2, e01289.
- Huang, C.W. et al. (2011) Neuroscience 176, 431.
- Menteyne, A. et al. (2009) PLoS ONE 4, e6770.
- Takacs, Z. et al. (2009) Proc. Natl. Acad. Sci. U.S.A. 106, 22211.
Specifications
Properties
Technical Specifications
Origin Synthetic peptide
MW 4091 Da
Sequence GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK.
Modifications Disulfide bonds between Cys8-Cys28, Cys14-Cys33, and Cys18-Cys35.
Peptide Content 100%
Purity >98% (HPLC)
Molecular formula C169H278N54O48S8.
CAS No. 168147-41-9
Accession number P46111.
Biological Activity
Target KV1.3 K+ channels
Effective concentration 50 pM - 10 nM.
Activity Agitoxin-2 is a blocker of Shaker voltage-gated K+ channels as well as the mammalian homologues of Shaker.
Solubility and Storage
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two week at 4°C or three months at -20°C.
Scientific Background
Scientific Background
Scientific background Native Agitoxin-2 was originally isolated from the venom of the Israeli scorpion L. quinquestriatus hebraeus.1 Agitoxin-2 inhibited the native KV1.3-like current in cultured microglia by 72% at 5 nM and KV1.3 in MLS-9 cells by 87%.2 Agitoxin-2 is a potent blocker of the Shaker voltage-gated K+-channels as well as the mammalian homologues of Shaker.1
References
- Garcia, M.L. et al. (1994) Biochemistry 33, 6834.
- Cayabyab, F.S. et al. (2000) Eur. J. Neurosci. 12, 1949.
Last Update: 08/01/2025