Overview
Alternative Name Potassium channel toxin α-KTx 3.2, AgTx-2, AgTx2, Agitoxin 2
Lyophilized Powder yes
Origin Synthetic peptide
MW: 4091 Da
Purity: >98% (HPLC)
Effective concentration 50 pM - 10 nM.
Sequence GVPINVSCTGSPQCIKPCKDAGMRFGKCMNRKCHCTPK.
Modifications Disulfide bonds between Cys8-Cys28, Cys14-Cys33, and Cys18-Cys35.
Structure
Molecular formula C169H278N54O48S8.
CAS No.: 168147-41-9
Activity Agitoxin-2 is a blocker of Shaker voltage-gated K+ channels as well as the mammalian homologues of Shaker.
Accession number P46111.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two week at 4°C or three months at -20°C.
Our bioassay
Alomone Labs Agitoxin-2 inhibits KV1.3 currents heterologously expressed in Xenopus oocytes.A. Time course of Agitoxin-2 (#STA-420) action on KV1.3 currents. Maximum current amplitudes at +50 mV were plotted as a function of time. Membrane potential was held at –80 mV and cells were stimulated by a 150 ms voltage ramp to +50 mV. 1 nM Agitoxin-2 was perfused as indicated by the bar (green) during 150 sec. B. Superimposed examples of KV1.3 channel current in the absence (control) and presence (green) of 1 nM Agitoxin-2 (taken from the experiment in A).
Scientific background Native Agitoxin-2 was originally isolated from the venom of the Israeli scorpion L. quinquestriatus hebraeus.1 Agitoxin-2 inhibited the native KV1.3-like current in cultured microglia by 72% at 5 nM and KV1.3 in MLS-9 cells by 87%.2 Agitoxin-2 is a potent blocker of the Shaker voltage-gated K+-channels as well as the mammalian homologues of Shaker.1
Target KV1.3 K+ channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 07/05/2024
Specifications
Citations
Citations
