Overview
- GST fusion protein with the sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 of rat KV1.2 (Accession P63142). Intracellular, C-terminus.
- Western blot analysis of rat brain membranes:1. Anti-KV1.2 (KCNA2) Antibody (#APC-010), (1:200).
2. Anti-KV1.2 (KCNA2) Antibody, preincubated with Kv1.2/KCNA2 Blocking Peptide (#BLP-PC010). - Western blot analysis of rat heart membranes:1. Anti-KV1.2 (KCNA2) Antibody (#APC-010), (1:200)
2. Anti-KV1.2 (KCNA2) Antibody, preincubated with Kv1.2/KCNA2 Blocking Peptide (#BLP-PC010).
- Multiplex staining of KV1.2 and KV1.1 in mouse cerebellumImmunohistochemical staining of mouse perfusion-fixed frozen brain sections using Anti-KV1.2 (KCNA2) Antibody (#APC-010), (1:300) and Anti-KV1.1 (KCNA1) (extracellular)-ATTO Fluor-594 Antibody (#APC-161-AR), (1:100). A. KV1.2 staining, followed by donkey-anti-rabbit-Cy2 (green). B. KV1.1 staining (red). C. Merge of the two images suggests considerable co-localization in the pinceau structures (up-pointing arrows). KV1.1 also appears in blood vessels (down-pointing arrows), where no KV1.2 expression is observed.
- Mouse cerebellum (1:350) (Kleopa, K.A. et al. (2006) Brain 129, 1570.).
- HeLa transfected cells (1:200) (Kleopa, K.A. et al. (2006) Brain 129, 1570.).
- McKinnon, D. (1989) J.Biol. Chem. 264, 8230.
- Gutman, G.A. et al. (2005) Pharmacol. Rev. 57, 473.
- Long, S.B. et al. (2005) Science 309, 897.
- Bogin, O. (2006) Modulator 21, 28.
KV1.2 is a mammalian voltage-dependent K+ channel, homologous to the Drosophila Shaker K+ channel. KV1.2 was first cloned from rat brain.1 Eight Shaker-related genes exist in mammals constituting the KV1 subfamily of the large KV channel family of genes.2
A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition several auxiliary subunits and intracellular proteins might interact with the channel and affect its function.
The structure of KV1.2 channel is similar to all KV channels and includes six membrane spanning helices creating a voltage sensor domain and a pore domain.2
The channel is expressed in neurons and cardiac and smooth muscle tissue as well as in retina and pancreas.2 The crystal structure of KV1.2 was recently solved shading light on the structure of a mammalian voltage dependent channel.3 The functional channel is considered low voltage activated and shows very little inactivation. Therefore, this channel activity influences the membrane potential and excitability of neurons and muscle.
KV1.2 channels are sensitive to high doses of TEA (560 mM) and low doses of 4-AP (0.59 mM), the “classical” non-selective potassium channel blockers.
Several venomous toxins from snakes, scorpions and honey bee are potent blockers (affecting the channels in the nanomolar range) of KV1.2 channels. Among these, the most potent and selective are α-Dendrotoxin (1-12 nM), Dendrotoxin-I (0.13 nM), Maurotoxin (0.1-0.8 nM), Hongotoxin-1 (0.17 nM), Margatoxin (0.16-0.65 nM), Tityustoxin Kα (0.21 nM) and MCD peptide (10-400 nM).4
Application key:
Species reactivity key:
Alomone Labs is pleased to offer a highly specific antibody directed against an epitope of rat KV1.2. Anti-KV1.2 (KCNA2) Antibody (#APC-010) can be used in western blot, immunohistochemistry, and immunocytochemistry applications. It has been designed to recognize KV1.2 from human, rat, and mouse samples.
Applications
Citations
- Human lung carcinoma cell line A549 isolated nuclei.
Jang, S.H. et al. (2015) J. Biol. Chem. 290, 12547. - Rat lung lysate.
Lv, Y. et al. (2013) Am. J. Physiol. 305, L856. - Mouse spinal cord lysate (1:1000).
Zoupi, L. et al. (2013) Glia 61, 1236.
- Rat lumbar spinal cord sections.
Wolff, M. et al. (2016) Neurosci. Res. 109, 16. - Rat DRGs.
Takahashi, R. et al. (2013) J. Urol. 190, 2296. - Mouse spinal cord and cortex sections (1:200).
Zoupi, L. et al. (2013) Glia 61, 1236. - Human artery tissues (1:50).
Gojkovic-Bukarica, L. et al. (2011) Eur. J. Pharmacol. 654, 266. - Mouse cerebellum (1:300).
Kleopa, K.A. et al. (2006) Brain 129, 1570.
- Rat hippocampus cell culture.
Sobieski, C. et al. (2015) J. Neurosci. 35, 11105. - HeLa transfected cells (1:200).
Kleopa, K.A. et al. (2006) Brain 129, 1570.
- Hao, J. et al. (2013) Neuron 77, 899.
- Horn, K.E. et al. (2013) Cell Rep. 3, 173.
- Bin, J.M. et al. (2012) PLoS ONE 7, e41237.
- Cazzin, C. et al. (2011) Genes Brain Behav. 10, 817.
- Gojkovic-Bukarica, L. et al. (2011) Eur. J. Pharmacol. 654, 266.
- Irani, S.R. et al. (2010) Brain 133, 2734.
- Savvaki, M. et al. (2010) J. Neurosci. 30, 13943.
- Sun, W. et al. (2010) J. Neurophysiol. 103, 469.
- Utsunomiya, I. et al. (2010) J. Neurochem. 112, 913.
- Hayashi, Y. et al. (2009) Am J. Physiol. 296, R1661.
- Hsiao, C.F. et al. (2009) J. Neurophysiol. 101, 1407.
- Cox, R.H. et al. (2008) Am. J. Hypertens. 21, 213.
- Gautier, M. et al. (2007) Am. J. Physiol. 292, 475.
- Neshatian, L. et al. (2007) Am. J. Physiol. 292, G1233.
- Rivera, J. et al. (2007) Eur. J. Neurosci. 25, 136.
- Susuki, K. et al. (2007) Glia 55, 746.
- Kuba, H. et al. (2006) Nature 444, 1069.
- Fordyce, C.B. et al. (2005) J. Neurosci. 25, 7139.
- Kuba, H. et al. (2005) J. Neurosci. 25, 1924.
- Wang, J. et al. (2005) Am. J. Physiol. 288, L1049.
- Karimi-Abdolrezaee, S. et al. (2004) Eur. J. Neurosci. 19, 577.
- Nakayama, H. et al. (2004) J. Neurosci. 24, 3199.
- Dodson, P.D. et al. (2003) J. Physiol. 550, 27.
- Popratiloff, A. et al. (2003) J. Comp. Neurol. 461, 466.
- Rios, J.C. et al. (2003) J. Neurosci. 23, 7001.
- Adamson, C.L. et al (2002) J. Neurosci. 22, 1385.
- Arroyo, E.J. et al. (2002) J. Neurosci. 22, 1726.
- Chittajallu, R. et. al. (2002) Proc. Natl. Acad. Sci. U.S.A. 99, 2350.
- Felix, R. et al. (2002) Zygote 10, 183.
- Chung, Y.H. et al. (2000) Brain Res. 875, 164.
- Conforti, L. et al. (2000) J. Physiol. 524, 783.
- Nashmi, R. et al. (2000) Eur. J. Neurosci. 12, 491.
- Arroyo, E.J. et al. (1999) J. Neurocytol. 28, 333.
- Sobko, A. et al. (1998) J. Neurosci. 18, 10398.
- Yuan, X.J. et al. (1998) Am. J. Physiol. 274, L621.
- Attali, B. et al. (1997) J. Neurosci. 17, 8234.
- Wang, J. et al. (1997) J. Clin. Invest. 100, 2347.