Name: Anti-KV1.4 Antibody
Brand: Alomone Labs
SKU: APC-007

Overview

Cat #: APC-007

Alternative Name Potassium voltage-gated channel subfamily A member 4, KCNA4

Lyophilized Powder yes

Type: Polyclonal

Host: Rabbit

Reactivity: h, m, r

Immunogen

GST fusion protein with the sequence PYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCGKEEKCQGKGDDSETDKNNCSNAKAVETDV, corresponding to amino acid residues 589-655 of rat K_V1.4 (Accession P15385). Intracellular, C-terminus.

Accession (Uniprot) Number P15385

Gene ID 25469

Peptide confirmation Confirmed by DNA sequence and SDS-PAGE.

Homology Mouse - identical; human - 66/67 (or 65/67) amino acid residues identical; bovine - 64/67 amino acid residues identical.

RRID AB_2040153.

Purity The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

Form Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4, 1% BSA, 5% sucrose, 0.025% NaN₃.

Form Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.

Isotype Rabbit IgG.

Storage before reconstitution The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C.

Reconstitution 25 µl, 50 µl or 0.2 ml double distilled water (DDW), depending on the sample size.

Reconstitution 0.2 ml double distilled water (DDW).

Antibody concentration after reconstitution 0.3 mg/ml.

Storage after reconstitution The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Standard quality control of each lot Western blot analysis.

Applications: ic, if, ih, wb

May also work in: ifc*, ip*

Western blot

Western blot analysis of rat brain membranes:
1. Anti-K_V1.4 Antibody (#APC-007), (1:200).
2. Anti-K_V1.4 Antibody, preincubated with Kv1.4 Blocking Peptide (#BLP-PC007).
Human left heart ventricle (1:50-1:100) (Szentadrassy, N. et al. (2005) Cardiovasc. Res. 65, 851.).

Immunohistochemistry

Rat brain sections (see also references 7-9 in publications using this product).

Immunocytochemistry

Rat neural progenitor cells (NPCs) (1:200) (Liebau, S. et al. (2006) J. Neurochem. 99, 426.).

References

Stuhmer, W. et al. (1989) EMBO J. 8, 3235.
Gutman, G.A. et al. (2005) Pharmacol. Rev. 57, 473.
Bogin, O. (2006) Modulator 21, 28.

Scientific background

K_V1.4 is a mammalian voltage-dependent K⁺ channel, homologous to the Drosophila Shaker K⁺ channel. K_V1.4 was first cloned from rat brain.¹ Eight Shaker-related genes exist in mammals constituting the K_V1 subfamily of the large K_V channel family of genes.²

A functional K_V1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition, several auxiliary subunits and intracellular proteins might interact with the channel and affect its function.

The structure of K_V1.4 channel is similar to all K_V channels and includes six membrane spanning helices creating a voltage sensor domain and a pore domain.²

The channel is expressed in neurons and cardiac and skeletal muscle tissue as well as in the pancreas.² The functional channel is considered transient (A-type) current and shows pronounced inactivation. Therefore, this channel activity influences the membrane potential and excitability of neurons and muscle.

K_V1.4 channels are sensitive to high doses of TEA (>100 mM) and low doses of 4-AP (0.013 mM), the “classical” non-selective potassium channel blockers.

Most venomous peptide toxins that affect other K_V channels do not inhibit K_V1.4. However, the sea anemone toxin Stichodactyla Toxin (ShK), which is more potent towards K_V1.1 and K_V1.3, is still a potent inhibitor of K_V1.4 channels.³

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Lyophilized Powder

Alomone Labs is pleased to offer a highly specific antibody directed against an epitope of rat K_V1.4. Anti-K_V1.4 Antibody (#APC-007) can be used in western blot, immunocytochemistry, and immunohistochemistry applications. It has been designed to recognize K_V1.4 from human, rat and mouse samples.

Certificate of Analysis SDS

For research purposes only, not for human use

Last Update: 29/10/2024

Applications

Citations

Western blot citations

Mouse cardiac HL-1 cell lysate.
Lu, Y.Y. et al. (2016) J. Cell. Mol. Med. 20, 1182.
Rat ventricular myocytes (1:200).
Liu, W.J. et al. (2015) Am. J. Physiol. 309, H1288.
Rat heart lysate.
Hsueh, C.H. et al. (2014) J. Am. Soc. Nephrol. 25, 2812.

Immunohistochemistry citations

Rat DRGs.
Takahashi, R. et al. (2013) J. Urol. 190, 2296.

More product citations

Riley, D. et al. (2010) J. Appl. Physiol. 108, 1003.
Hayashi, Y. et al. (2009) Am J. Physiol. 296, R1661.
Herrero-Herranz, E. et al. (2007) Am. J. Pathol. 171, 589.
Sonner, P.M. and Stern, J.E. (2007) J. Physiol. 582, 1219.
Liebau, S. et al. (2006) J. Neurochem. 99, 426.
Rose, J. et al. (2005) Am. J. Physiol. 288, H2077.
Szentadrassy, N. et al. (2005) Cardiovasc. Res. 65, 851.
Wang, J. et al. (2005) Am. J. Physiol. 288, L1049.
Xu, Y. et al. (2005) J. Physiol. 562.3, 745.
Xia, F. et al. (2004) J. Biol. Chem. 279, 24685.
Dodson, P.D. et al. (2003) J. Physiol. 550.1, 27.
Aydar, E. et al. (2002) Neuron 34, 399.
Dodson, P.D. et al. (2002) J. Neuroscience 22, 6953.
Chittajallu, R. et. al. (2002) Proc. Natl. Acad. Sci. U.S.A. 99, 2350.
MacDonald, P.E. et al. (2002) Diabetes 51, 443.
MacDonald, P.E. et al. (2002) J. Biol. Chem. 277, 44938.
Chung, Y.H. et al. (2000) Brain Res. 875, 164.
Gopel, S.O. et al. (2000) J. Physiol. 528.3, 497.
Mienville, J.M. et al (1999) J. Neurophysiol. 82, 1303.
Guo, W. et al. (1998) J. Mol. Cell Cardiol. 30, 1449.
Meiri, N. et al. (1998) Proc. Natl. Acad. Sci. U.S.A. 95, 15037.
Sobko, A. et al. (1998) J. Neurosci. 18, 10398.
Yuan, X.J. et al. (1998) Am. J. Physiol. 274, L621.
Attali, B. et al. (1997) J. Neurosci. 17, 8234.
Guo, W. et al. (1997) Eur. J. Physiol. 434, 206.

Specifications

Scientific Background

Specific Control Product

Kv1.4 Blocking Peptide (#BLP-PC007) is the original antigen used for immunization during Anti-K_V1.4 Antibody (#APC-007) generation. The blocking peptide binds and ‘blocks’ Anti-Kv1.4 primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.

Kv1.4 Blocking Peptide (#BLP-PC007)

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.

Reagent Rewards

Not sure whether the product fits your experimental setup?

Try it first!

Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Navigation

Order Summary

Anti-K_V1.4 Antibody