Overview
- GST fusion protein with the sequence PYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCGKEEKCQGKGDDSETDKNNCSNAKAVETDV, corresponding to amino acid residues 589-655 of rat KV1.4 (Accession P15385). Intracellular, C-terminus.
- Western blot analysis of rat brain membranes:1. Anti-KV1.4 Antibody (#APC-007), (1:200).
2. Anti-KV1.4 Antibody, preincubated with Kv1.4 Blocking Peptide (#BLP-PC007). - Rat brain membranes (1:200). Human left heart ventricle (1:50-1:100) (Szentadrassy, N. et al. (2005) Cardiovasc. Res. 65, 851.).
- Rat brain sections (see also references 7-9 in publications using this product).
- Rat neural progenitor cells (NPCs) (1:200) (Liebau, S. et al. (2006) J. Neurochem. 99, 426.).
KV1.4 is a mammalian voltage-dependent K+ channel, homologous to the Drosophila Shaker K+ channel. KV1.4 was first cloned from rat brain.1 Eight Shaker-related genes exist in mammals constituting the KV1 subfamily of the large KV channel family of genes.2
A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition, several auxiliary subunits and intracellular proteins might interact with the channel and affect its function.
The structure of KV1.4 channel is similar to all KV channels and includes six membrane spanning helices creating a voltage sensor domain and a pore domain.2
The channel is expressed in neurons and cardiac and skeletal muscle tissue as well as in the pancreas.2 The functional channel is considered transient (A-type) current and shows pronounced inactivation. Therefore, this channel activity influences the membrane potential and excitability of neurons and muscle.
KV1.4 channels are sensitive to high doses of TEA (>100 mM) and low doses of 4-AP (0.013 mM), the “classical” non-selective potassium channel blockers.
Most venomous peptide toxins that affect other KV channels do not inhibit KV1.4. However, the sea anemone toxin Stichodactyla Toxin (ShK), which is more potent towards KV1.1 and KV1.3, is still a potent inhibitor of KV1.4 channels.3