Overview
- GST fusion protein with the sequence VANQDPVSPSLVQGRIVKPN NNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSV SAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKS DSCTPTNTTVEVVGSSGQNGDE, corresponding to amino acid residues 225-356 of human M2 (Accession P08172). 3rd intracellular loop.
- Rat brain membranes (1:200).
Western blot analysis of rat brain membranes:1. Anti-CHRM2 Antibody (#AMR-002), (1:200).
2. Anti-CHRM2 Antibody, preincubated with CHRM2 Blocking Peptide (#BLP-MR002).
- Xenopus oocyte membranes (Vorobiov, D. et al. (2000) J. Biol. Chem. 275, 4166.).
- Rat brain sections and mouse parieto-temporal cortex sections. Human colon (1:50) (Harrington, A.M. et al. (2010) Neurogastroenterol. Motil. 22, 999.).
- Mouse HL-1 cells (1:500) (Nobles, M. et al. (2010) Pflugers Arch. 460, 99.).
The action of the neurotransmitter acetylcholine is mediated through two types of receptors, the ionotropic nicotinic receptors and the metabotropic muscarinic receptors. The muscarinic receptors belong to the superfamily of 7-transmembrane G-protein coupled receptors. Five subtypes of muscarinic receptors have been cloned and are named M1-M5.1-2
The muscarinic receptors are widely distributed throughout the body but are predominantly expressed in the parasympathetic nervous system and exert both excitatory and inhibitory control over central and peripheral tissues.1-2
Muscarinic receptors participate in a number of physiological functions such as regulation of heart rate, muscle contraction, cognition, sensory processing, and motor control.1 They also participate in learning and memory processing.3-4
The M2 receptor is considered to be the predominant muscarinic receptor subtype that is expressed in cardiac muscle.5
The M2 and M4 receptors mediate Ca2+ channel inhibition and Kir3 K+ channel activation by directly binding the Gβγ subunit to the channel.6,7 Stimulation of the M2 receptor by acetylcholine in the heart results in activation of the Kir3.1/Kir3.4 channels causing a slowing in heart beat.7
