Overview
APETx2 (#STA-160) is a highly pure, synthetic, and biologically active peptide toxin.
Alternative Name Toxin APETx2, Pi-AITX-Ael2b, Pi-actitoxin-Ael2b
Structure
For research purposes only, not for human use
Applications
Citations (40)
Citations
Powered by BiozProduct citations
- Su, Y.S. et al. (2018) Neuropharmacology 130, 92.
- Zhou, R.P. et al. (2018) Gene 642, 230.
- Burgos-Vega, C.C. et al. (2016) Pain 157, 2722.
- Cao, Q. et al. (2016) Mol. Neurobiol. 53, 485.
- Fu, H. et al. (2016) Clin. Exp. Pharmacol. Physiol. 43, 193.
- Gao, M. et al. (2016) Eur. J. Ortho. 38, 577.
- Xu, X.X. et al. (2016) Eur. J. Pain 20, 552.
- Yu, X.W. et al. (2015) Glia 63, 483.
- Chen, W.N. and Chen, C.C. (2014) Mol. Pain 10, 30.
- Martinez-Rojas, V.A. et al. (2014) Pharmacol. Rep. 66, 964.
- Radu, B.M. et al. (2014) Cell Biochem. Biophys. 68, 9.
- Yan, J. et al. (2013) Headache 53, 1250.
- Izumi, M. et al. (2012) J. Biomed. Sci. 19, 77.
Specifications
Properties
Technical Specifications
Origin Synthetic peptide
MW 4561 Da
Sequence GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD.
Modifications Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38.
Peptide Content 100%
Purity >98% (HPLC)
Molecular formula C196H280N54O61S6.
CAS No. 713544-47-9
Accession number
Biological Activity
Target ASIC3 channels
Effective concentration 10 nM - 3 µM.
Activity APETx2 inhibits ASIC3 channels1.
References
- Chagot, B. et al. (2005) Protein Sci. 14, 2003.
Solubility and Storage
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to one week at 4°C or three months at -20°C.
Scientific Background
Scientific Background
Scientific background
Natural APETx2 is a 42-amino-acid peptidyl toxin, originally isolated from the sea anemone Anthopleura elegantissima. APETx2 was shown to be a selective, potent and reversible blocker of the homodimer proton gated channel ASIC3. ASIC3 has been implicated in pain transduction associated with acidosis in inflamed or ischemic tissues. APETx2 directly inhibits the ASIC3 channel by acting at its external side of the channel in a pH dependent manner.
APETx2 also inhibits the hetromer ASIC2b-ASIC3 channel but does not inhibit the activity of ASIC1 isoform1.
Structurally APETx2 is related to APETx1 a toxin that targets HERG K+ channel1,2.
References
- Diochot, S. et al. (2004) EMBO J. 23, 1516.
- Chagot, B. et al. (2005) Protein Sci. 14, 2003.
- Gao, M. et al. (2016) Eur. J. Ortho. 38, 577.
- Yan, J. et al. (2013) Headache 53, 1250.
- Izumi, M. et al. (2012) J. Biomed. Sci. 19, 77.
Last Update: 08/01/2025
