Name: Aquaporin 4/AQP4 (249-323) Blocking Peptide
Brand: Alomone Labs
SKU: BLP-QP004

Back to product page SDS

Cat #: BLP-QP004

Size: 0.12 mg

Type: GST fusion protein

Form: Lyophilized powder

Applications: wb, ihc

Application key:

WB- Western blot, IHC- Immunohistochemistry

For research purposes only. not for human use

Properties

Sequence

GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV, corresponding to amino acid residues 249-323 of rat AQP4 (Accession P47863).

Accession (Uniprot) Number P47863

Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.

Purity >95% (SDS-PAGE)

Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.

Reconstitution 100 µl double distilled water (DDW).

Concentration After Reconstitution 1.2 mg/ml.

Storage After Reconstitution -20°C.

Antigen Preadsorption Control 3 µg fusion protein per 1 µg antibody.

Standard Quality Control Of Each Lot Western blot analysis.

Applications

Demonstration of Pre-adsorption control

Western blot analysis of rat brain membranes:
1. Anti-Aquaporin 4 (AQP4) (249-323) Antibody (#AQP-004), (1:1000).
2. Anti-Aquaporin 4 (AQP4) (249-323) Antibody, preincubated with the control fusion protein (BLP-QP004).
Rat brain (1:200) (Jo, S.M. et al. (2011) Neurosci. Lett. 501, 25.).

Mouse kidney (Langaa, S. et al. (2012) Am. J. Physiol. 302, F1034.).

Last update: 02/01/2024

Specific Use it with:

Alomone Labs is pleased to offer a highly specific antibody directed against an epitope located at the intracellular C-terminal domain of rat AQP4. Anti-Aquaporin 4 (AQP4) (249-323) Antibody (#AQP-004) can be used in western blot, immunocytochemical, immunohistochemical and indirect flow cytometry applications. It recognizes the Aquaporin 4 channel from rat, mouse and human samples.

Anti-Aquaporin 4 (AQP4) (249-323) Antibody (#AQP-004)