Overview
Alternative Name Alpha-like toxin BmK-M1, BmK I, BmK-I, BmK1, Bmk M1, BmKM1
Lyophilized Powder yes
Origin Synthetic peptide
MW: 7217 Da
Purity: >98% (HPLC)
Form Lyophilized powder.
Effective concentration 500-1000 nM.
Sequence VRDAYIAKPHNCVYECARNEYCNDLCTKNGAKSGYCQWVGKYGNGCWCIELPDNVPIRVPGKCH.
Modifications Disulfide bonds between Cys12-Cys63, Cys16-Cys36, Cys22-Cys46 and Cys26-Cys48.
Structure
Molecular formula C313H467N91O91S8.
Activity BmKI Toxin inhibits the inactivation of activated voltage-gated Na+ channels.
References-Activity
- Cao, Z. et al. (2014) Toxins 6, 796.
Accession number P45697.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
Alomone Labs BmKI Toxin enhances NaV1.6 channel currents in Xenopus oocytes.A. Representative time course of BmKI Toxin (#STB-100) effect on the normalized area of NaV1.6 channel current. Membrane potential was held at -100 mV, current was elicited by a 100 ms voltage step to +10 mV every 10 sec and was enhanced by the application of 1 µM BmKI Toxin (green). B. Superimposed traces of NaV1.6 current following application of control (black) and of 1 µM BmKI Toxin (green), taken from the recording in A.
Scientific background BmKI Toxin (Alpha-like toxin BmK-M1) is a peptide toxin originally isolated from Mesobuthus martensii scorpion venom. It is a positive modulator of voltage-gated Na+ channels by inhibiting the inactivation of activated NaV channels. BmKI Toxin activity was demonstrated on NaV1.4, NaV1.5, NaV1.6 channels.
The structure of BmKI Toxin includes a motif consisting of one or two short segments of α‐helix and a triple‐stranded β‐sheet, connected by variable regions forming loops1,2.
There are nine mammalian subtypes of voltage-gated sodium (NaV) channels: NaV1.1–NaV1.9. These channels responsible for propagating action potentials in excitable cells and are important therapeutic targets for numerous pathophysiological conditions such as cardiac arrhythmia, and epilepsy3.
Target NaV1.4, NaV1.5, NaV1.6
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 07/05/2024
Specifications
Citations
Citations
