Overview
|
Cat #:
STC-325
Purity: >98% (HPLC)
CAS No.: 95751-30-7
MW: 4296 Da
Form: Lyophilized
Charybdotoxin (#STC-325) is a highly pure, synthetic, and biologically active peptide toxin.
Alternative Name K+ channel toxin α-KTx 1.1, ChTX, ChTX-Lq1, ChTx-a
MW: 4296 Da
For research purposes only, not for human use
Applications
Our Bioassay
Our bioassay
- Alomone Labs Charybdotoxin inhibits KCa1.1 channels heterologously expressed in Xenopus oocytes.A. Example of time course showing reversible effect of 20 nM and 50 nM Charybdotoxin (#STC-325) during 100 sec application on the current amplitude. Membrane holding potential was -100 mV stepped to 0 mV during 200 ms following another step to 80 mV during 600 msec. B. Superimposed example traces of KCa1.1 channel currents in response to ramp depolarization before (Control) and during the application of 20 nM or 50 nM of Charybdotoxin for 100 sec.
Citations (14)
Citations
Product citations
- Fellerhoff-Losch, B. et al. (2015) J. Neural Transm. 123, 137.
- Lee, J. et al. (2014) Develop. Neurobiol. 74, 1.
- Lopez-Gonzalez, I. et al. (2014) Mol. Hum. Reprod. 20, 619.
- Brereton, M.F. et al. (2013) PLoS ONE 8, e57451.
- Cao, Z. et al. (2013) Nat. Commun. 4, 1.
- Chen, M. et al. (2013) Mol. Neurobiol. 48, 794.
- Gonzalez Corrochano, R. et al. (2013) Br. J. Pharmacol. 169, 449.
- Cosyns, S.M. and Lefebvre, R.A. (2012) Eur. J. Pharmacol. 686, 104.
- Sun, P. et al. (2011) J. Neurosci. 31, 16464.
- Tanner, G.R. et al. (2011) J. Neurosci. 31, 8689.
- Malinina, E. et al. (2010) J. Neurophysiol. 104, 200.
- Sciaccaluga, M. et al. (2010) Am. J. Physiol. 299, C175.
- Dhaese, I. and Lefebvre, R.A. (2009) Eur. J. Pharmacol. 606, 180.
- Begg, M. et al. (2001) J. Physiol. 531, 95.
Specifications
Properties
Technical Specifications
Origin Synthetic peptide
MW 4296 Da
Sequence ZFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS.
Modifications Disulfide bonds between Cys7-Cys28, Cys13-Cys33, and Cys17-Cys35, Z= Pyrrolidone carboxylic acid.
Peptide Content 100%
Purity >98% (HPLC)
Molecular formula C176H277N57O55S7.
CAS No. 95751-30-7
Accession number P13487.
Biological Activity
Target KCa1.1, KV1.2, KV1.3 K+ channels
Effective concentration 10-100 nM.
Activity Charybdotoxin is a potent selective inhibitor of high conductance (maxi-K), different medium and small conductance Ca2+-activated K+ channels, as well as a voltage-dependent K+ channel (KV1.3)1.
References
- Gimenez-Gallego, G. et al. (1988) Proc. Natl. Acad. Sci. U.S.A. 85, 3329.
Solubility and Storage
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Scientific Background
Scientific Background
Scientific background Charybdotoxin was originally isolated from the venom of the Israeli scorpion Leiurus quinquestriatus hebraeus1. Charybdotoxin blocks KCa1.1 (large conductance Ca2+-activated K+, Slo) channels in nM concentrations2 as well as KV1.2 (Kd, 14 nM) and KV1.3 (Kd, 2.6 nM) channels3. However, experiments with cloned KCa1.1 channels demonstrate the strong effect of the sloβ subunits on the potency of block by Charybdotoxin (see for example 4).
References
- Gimenez-Gallego, G. et al. (1988) Proc. Natl. Acad. Sci. U.S.A. 85, 3329.
- Miller, C. et al. (1985) Nature 313, 316.
- Grissmer, S. et al. (1994) Mol. Pharmacol. 45, 1227.
- Meera, P. et al. (2000) Proc. Natl. Acad. Sci. U.S.A. 97, 5562.
- Sugg, E.E. et al. (1990) J. Biol. Chem. 265, 18745.
Last Update: 08/01/2025