Overview
Cat #:
F-650
Alternative Name Fasciculin-1, Fas-1, Fas1, FAS-I, Toxin TA1
Lyophilized Powder yes
Origin Natural peptide isolated from Dendroaspis angusticeps (Eastern green mamba).
MW: 6791 Da
Purity: >99% (HPLC)
Effective concentration 1-10 nM.
Sequence TMCYSHTTTSRAILTNCGENSCYRKSRRHPPKMVLGRGCGCPPGDDYLEVKCCTSPDKCNY.
Modifications Disulfide bonds between Cys3-Cys22, Cys17-Cys39, Cys41-Cys52 and Cys53-Cys59.
Molecular formula C281H441N87O90S10.
Activity Fasciculin-I selectively and potently binds and inhibits acetylcholinesterase.
References-Activity
- Anglister, L. et al. (1978) J. Mol. Biol. 125, 293.
- Ellman, G.L. et al. (1961) Biochem. Pharmacol. 7, 88.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any conventional buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or six months at -20°C.
Our bioassay
- Alomone Labs Fasciculin-I potently inhibits Acetylcholinesterase (AChE) activity.AChE activity was determined colorimetrically using Ellman's reagent, as production of thiocholine from acetylthiocholine. Absorbance was measured at 405 nm after a 30 min incubation. Normalized activity of 400 mU/ml human AChE, as per cent of control, was plotted against increasing concentrations of Fasciculin-I (#F-650), showing concentration-dependent inhibition with pIC50 ≈ 6.7.
Scientific background
Fasciculin-I is a 61 amino acid peptidyl toxin with four disulfide bonds, isolated from the Eastern green mamba (Dendroaspis angusticeps) venom. Fasciculin-I belongs to the three finger toxin family, structurally similar to the short alpha-neurotoxins and cardiotoxins1.
Fasciculin-I was shown to be a selective, potent, and reversible blocker of the mammalian acetylcholinesterase (AChE) at picomolar concentrations1. Injection of Fasciculin-I to mice causes severe generalized and long-lasting twitch (fasciculation) due to its ability to accumulate acetylcholine at the neuromuscular junction2.
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 02/01/2024
Specifications
Citations
Citations