Add $870 to your cart to get your free sample.
Overview
FS-2 (#F-700) is a highly pure, natural, and biologically active peptide toxin.
Structure
For research purposes only, not for human use
Applications
Citations (2)
Citations
Powered by BiozProduct citations
- Copello, J.A. et al. (2007) Am. J. Physiol. 292, C2129.
Specifications
Properties
Technical Specifications
Origin Natural peptide isolated from Dendroaspis polylepis polylepis (Black mamba snake).
MW 7026 Da
Sequence RICYSHKASLPRATKTCVENTCYKMFIRTHRQYISERGCGCPTAMWPYQTECCKGDRCNK.
Modifications Disulfide bonds between Cys3-Cys22, Cys17-Cys39, Cys41-Cys52 and Cys53-Cys58.
Peptide Content 100%
Purity >98% (HPLC)
Molecular formula C297N470N92O86S10.
CAS No. 63653-99-6
Biological Activity
Target L-type Ca2+ channels
Effective concentration 100 nM - 2 ֲµM.
Activity FS-2 is an L-type CaV channel blocker1.
References
- Yasuda, O. et al. (1994) Artery 21, 287.
Solubility and Storage
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Scientific Background
References
Scientific background
FS-2 is a natural peptidyl toxin isolated from the Dendroaspis p. polylepsis black mamba venom by a modification of the procedure of Schweitz et al.1 and purified to homogenity. FS-2 is an L-type CaV channel blocker.2 The toxin reduced (±)Bay K8644-induced [Ca2+]in increase, in smooth muscle cells as determined by Ca2+ imaging with Fura-2.2 The IC50 for this effect was 23 nM.
FS-2 induced relaxation in pre-constricted rat aorta, pulmonary artery and trachea.3 In addition, it inhibited acetylcholine-induced contractions in guinea pig ileum.
References
- Schweitz, H. et al. (1990) Toxicon 28, 847.
- Yasuda, O. et al. (1994) Artery 21, 287.
- Watanabe, T.X. et al. (1995) Jpn. J. Pharmacol. 68, 305.
Last Update: 08/01/2025
