Overview
Type: GST fusion protein
Form: Lyophilized powder
GIRK1/Kir3.1 Blocking Peptide (#BLP-PC005) is the original antigen used for immunization during Anti-GIRK1 (Kir3.1) Antibody (#APC-005) generation. The blocking peptide binds and ‘blocks’ Anti-GIRK1/Kir3.1 primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.
Applications: wb, ihc
For research purposes only. not for human use
Applications
Demonstration of Pre-adsorption control
Western blot analysis of rat brain membranes:1. Anti-GIRK1 (Kir3.1) Antibody (#APC-005), (1:200).
2. Anti-GIRK1 (Kir3.1) Antibody, preincubated with the control antigen.- Rat brain sections.
Human skin sections (1:200) (Nockemann, D. et al. (2013) EMBO Mol. Med. 5, 1263.).
Properties
Sequence
- GST fusion protein with the sequence LQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGPTRMEGNLPAKLRKMNSDRFT, corresponding to residues 437-501 of mouse GIRK1 (Accession P63250).
Accession (Uniprot) Number P63250
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 μl PBS.
Concentration After Reconstitution 1.2 mg/ml.
Storage After Reconstitution -20°C.
Antigen Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Standard Quality Control Of Each Lot Western blot analysis.
