Overview
Alternative Name µ-TRTX-Hhn2a, HnTx-III, Hainantoxin-3
Lyophilized Powder yes
Origin Synthetic peptide
MW: 3608 Da
Purity: >98% (HPLC)
Effective concentration 1-5 nM.
Sequence GCKGFGDSCTPGKNECCPNYACSSKHKWCKVYL.
Modifications Disulfide bonds between Cys2-Cys17, Cys9-Cys22, Cys16-Cys29. Leu33 – C-terminal amidation.
Structure
Molecular formula C154H228N44O45S6.
Activity Hainantoxin-III blocks TTX-sensitive voltage-gated Na+ channels (IC50 = 1.1 nM)1.
References-Activity
- Xiao, Y. and Liang, S. (2003) Eur. J. Pharmacol. 477, 1.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
Alomone Labs Hainantoxin-III inhibits NaV1.7 channels heterologously expressed in HEK293 cells.NaV1.7 currents were elicited by 30 ms voltage ramp from the holding potential of -100 mV to +60 mV, applied every 10 sec using whole-cell voltage clamp technique. A. Time course of NaV1.7 current amplitude changes before (black) and during (green) application of 0.5 µM Hainantoxin-III (#STH-120) indicated by the horizontal bar. B. Superimposed example current traces of NaV1.7 currents before (black) and during (green) 200 sec application of 0.5 µM Hainantoxin-III, as indicated.
Scientific background
Hainantoxin-III is a 33 amino acid peptidyl toxin isolated from the Haplopelma hainanum (Selenocosmia hainana, Chinese bird) tarantula spider1.
Hainantoxin-III strongly depresses the amplitude of TTX-sensitive Na+ currents with IC50 value of 1.1 nM1. It causes a hyperpolarizing shift of about 10 mV in the voltage midpoint of steady-state Na+ channel inactivation and significantly decreases the recovery rate from inactivation1.
The Haplopelma hainanum tarantula spider venom was recently found to be a source of various toxic components with different pharmacological properties2. 192 mature toxin sequences were identified by DNA sequencing technique. Hainantoxin-III was one of the toxins identified2.
Target TTX-sensitive NaV Na+ channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 07/05/2024
Specifications
Citations
Citations
