Overview
Cat #:
STH-130
Alternative Name μ-theraphotoxin-Hhn1b, μ-TRTX-Hhn1b, Hainantoxin-4, HnTx-IV, Peptide F8-18.88
Lyophilized Powder yes
Origin Synthetic peptide
MW: 3987 Da
Purity: >98% (HPLC)
Form Lyophilized powder.
Effective concentration 20-250 nM.
Sequence ECLGFGKGCNPSNDQCCKSSNLVCSRKHRWCKYEI.
Modifications Disulfide bonds between Cys2-Cys17, Cys9-Cys24, and Cys16-Cys31. Ile35 – C-terminal amidation.
Structure
Molecular formula C166H257N53O50S6.
Activity Neural TTX-sensitive voltage-gated Na+ channel inhibitor1,2.
References-Activity
- Liu, Z. et al. (2003) Cell. Mol. Life Sci. 60, 972.
- Xiao, Y. and Liang, S. (2003) Eur. J. Pharm. 477, 1.
Accession number D2Y232.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
- Alomone Labs Hainantoxin-IV inhibits NaV1. 2 currents heterologously expressed in Xenopus oocytes.A. Time course of Hainantoxin-IV (#STH-130) action on NaV1.2 currents. Maximum current amplitudes were plotted as a function of time. Membrane potential was held at -100 mV and cells were stimulated by a 100 ms voltage ramp to -10 mV. 50 nM (green) and 250 nM (red) Hainantoxin-IV were perfused as indicated by the bars during 360 sec and 260 sec, respectively. B. Superimposed NaV1.2 channel current traces in the absence and presence of 50 nM (green) or 250 nM (red) Hainantoxin-IV (taken from the experiment in A).
References - Scientific background
- Dongling, Li. et al. (2004) J. Biol. Chem. 279, 37734.
- Liu, Y. et al. (2012) J. Pept. Sci. 18, 643.
Scientific background Hainantoxin-IV (HNTX-IV) is a 35-amino acid peptidyl toxin originally isolated from the venom of the Chinese bird spider Ornithoctonus hainana Liang (Selenocosmia hainana Liang). HNTX-IV is a potent and selective inhibitor of TTX-sensitive NaV channels1. It has been shown to specifically inhibit the neuronal TTX-S VGSCs with an IC50 of 34 nM in adult rat dorsal root ganglion (DRG) neurons. HNTX-IV blocks neuromuscular transmission in the isolated nerve-synapse preparations of rat. HNTX-IV seems to interact with neurotoxin receptor site 1 through a mechanism quite similar to that of TTX without affecting the activation and inactivation kinetics. The toxin has six cysteine residues that form three disulfide bonds are clustered together in small peptides2.
Target TTX-sensitive NaV channels
Peptide Content: 100%
Lyophilized Powder
Hainantoxin-IV (#STH-130) is a highly pure, synthetic, and biologically active peptide toxin.
For research purposes only, not for human use
Last Update: 08/01/2025
Applications
Citations
Citations