Overview
Cat #:
STH-340
Alternative Name κ-Sparatoxin-Hv1b, κ-SPRTX-Hv1b, Toxin KJ6, HpTX2
Lyophilized Powder yes
Origin Synthetic peptide
MW: 3413 Da
Purity: >98% (HPLC)
Effective concentration 100-500 nM.
Sequence DDCGKLFSGCDTNADCCEGYVCRLWCKLDW.
Modifications Disulfide bonds between Cys3-Cys17, Cys10-Cys22, and Cys16-Cys26. Trp30 - C-terminal amidation.
Molecular formula C144H213N39O46S6.
Activity Heteropodatoxin-2 is an inhibitor of voltage-gated K+ channels of the KV4 family. Inhibition of KV4.3 and KV4.2 is strongly voltage-dependent, while inhibition of KV4.1 shows less voltage-dependence. Lacks affinity for KV1.4, KV2.1 and KV3.41,2. Also blocks Ca2+ channels1.
References-Activity
- Sanguinetti, M.C. et. al. (1997) Mol. Pharmacol. 51, 491.
- Zarayskiy, V.V. et al. (2005) Toxicon 45, 431.
Accession number P58426
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to one week at 4°C or three months at -20°C.
Our bioassay
- Alomone Labs Heteropodatoxin-2 inhibits KV4.2 channel currents expressed in Xenopus oocytes.Currents were elicited by application of voltage step from a holding potential of -100 mV to 0 mV in 100 msec, delivered every 10 seconds. A. Time course of channel activity (current amplitude at +0 mV), before (black) and during (green) application of 100 nM Heteropodatoxin-2 (#STH-340). B. Example of superimposed current traces before (black) and during (green) application of 100 nM Heteropodatoxin-2, taken from the experiment in A.
Scientific background Heteropodatoxin-2 is a synthetic peptide purified to homogeneity, originally isolated from the Heteropoda venatoria spider venom1,2. Heteropodatoxin-2 is an inhibitor of voltage-gated K+ channels of the KV4 family. Inhibition of KV4.3 and KV4.2 is strongly voltage-dependent, while inhibition of KV4.1 shows less voltage-dependence. Heteropodatoxin-2 lacks affinity for KV1.4, KV2.1 and KV3.41,3. It also blocks Ca2+ channels1.
Target KV4 K+ channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 07/05/2024
Specifications
Citations
Citations