Overview
Cat #:
STH-340
Purity: >98% (HPLC)
MW: 3413 Da
Form: Lyophilized
Alternative Name κ-Sparatoxin-Hv1b, κ-SPRTX-Hv1b, Toxin KJ6, HpTX2
MW: 3413 Da
Scientific background Heteropodatoxin-2 is a synthetic peptide purified to homogeneity, originally isolated from the Heteropoda venatoria spider venom1,2. Heteropodatoxin-2 is an inhibitor of voltage-gated K+ channels of the KV4 family. Inhibition of KV4.3 and KV4.2 is strongly voltage-dependent, while inhibition of KV4.1 shows less voltage-dependence. Heteropodatoxin-2 lacks affinity for KV1.4, KV2.1 and KV3.41,3. It also blocks Ca2+ channels1.
For research purposes only, not for human use
Specifications
Properties
Technical Specifications
Origin Synthetic peptide
MW 3413 Da
Sequence DDCGKLFSGCDTNADCCEGYVCRLWCKLDW.
Modifications Disulfide bonds between Cys3-Cys17, Cys10-Cys22, and Cys16-Cys26. Trp30 - C-terminal amidation.
Peptide Content 100%
Purity >98% (HPLC)
Molecular formula C144H213N39O46S6.
Accession number P58426
Biological Activity
Target KV4 K+ channels
Effective concentration 100-500 nM.
Activity Heteropodatoxin-2 is an inhibitor of voltage-gated K+ channels of the KV4 family. Inhibition of KV4.3 and KV4.2 is strongly voltage-dependent, while inhibition of KV4.1 shows less voltage-dependence. Lacks affinity for KV1.4, KV2.1 and KV3.41,2. Also blocks Ca2+ channels1.
References
- Sanguinetti, M.C. et. al. (1997) Mol. Pharmacol. 51, 491.
- Zarayskiy, V.V. et al. (2005) Toxicon 45, 431.
Solubility and Storage
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to one week at 4°C or three months at -20°C.
Applications
Our Bioassay
Our bioassay
- Alomone Labs Heteropodatoxin-2 inhibits KV4.2 channel currents expressed in Xenopus oocytes.Currents were elicited by application of voltage step from a holding potential of -100 mV to 0 mV in 100 msec, delivered every 10 seconds. A. Time course of channel activity (current amplitude at +0 mV), before (black) and during (green) application of 100 nM Heteropodatoxin-2 (#STH-340). B. Example of superimposed current traces before (black) and during (green) application of 100 nM Heteropodatoxin-2, taken from the experiment in A.
Last Update: 08/01/2025