Overview
Alternative Name δ-buthitoxin-Hj1a, Delta-buthitoxin-Hj1a
Lyophilized Powder yes
Origin Synthetic peptide
MW: 7482.4 Da
Purity: >95% (HPLC)
Form Lyophilized powder
Effective concentration 1 µM
Sequence EEVRDAYIAQPHNCVYHCFRDSYCNDLCIKHGAESGECKWFTSSGNACWCVKLPKSEPIKVPGKCH
Modifications Disulfide bonds between Cys14-Cys65, Cys18-Cys38, Cys24-Cys48 and Cys28-Cys50
Structure
Molecular formula C326H482N92O96S8
Activity Hj1a Toxin is an activator of NaV1.1 which presents dual α/β activity by modifying both the activation and inactivation properties of the channel1.
Accession number P0DQN8
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Soluble in water. Centrifuge all products before use (10000 x g, 5 min).
Storage of solutions Store at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing.
Our bioassay
Alomone Labs Hj1a Toxin enhances NaV1.1 channel currents expressed in HEK293 cells.Representative superimposed traces of NaV1.1 currents in the absence (black) or presence (red) of 1 µM Hj1a Toxin (#STH-450). Currents were elicited by a 20 ms voltage step to potentials ranging from -80 to +40 mV in 10 mV increments from a holding potential of -120 mV.
This figure was kindly provided by the lab of Dr. Moran Rubinstein, Goldschleger Eye Research Institute, The Department of Human Molecular Genetics and Biochemistry, Sackler School of Medicine, Tel Aviv University.
Scientific background
Hj1a is a peptide toxin originally isolated from the Hottentotta jayakari scorpion venom. Hj1a acts as a potent NaV1.1 channel activator. Hj1a is unique in that it presents a dual α/β activity by modifying both the activation and inactivation properties of the channel1.
NaV1.1 is predominantly expressed in inhibitory interneurons of the brain and it plays a major role in regulating brain rhythms and cognitive functions. Mutations in NaV1.1 channel were shown to be related to Dravet syndrome (DS), a severe form of pediatric epilepsy. NaV1.1 selective modulators can be useful therapeutics for treatment of DS as they target the underlying molecular deficit2.
Target Nav1.1 channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 07/05/2024
Specifications
Citations
Citations
