Overview
Alternative Name Enovin, Neublastin
Lyophilized Powder yes
Sterile & Endotoxin Free yes
Origin Recombinant, E. coli
MW: 24 kDa (dimer)
Endotoxin Level <0.1 EU per 1 µg of the protein by the LAL method.
Purity: >98% (HPLC)
Form Lyophilized from a 0.2 µm filtered solution.
Effective concentration 0.1-10 nM.
Sequence AGGPGSRARAAGARGCRLRSQLVPVRALGLGHRSDELVRFRFCSGSCRRARSPHDLSLASLLGAGALRPPPGSRPVSQPCCRPTRYEAVSFMDVNSTWRTVDRLSATACGCLG.
Modifications Inter-chain disulfide bonds between Cys16-Cys81, Cys43-Cys109, Cys47-Cys111 and intra-chain disulfide bond between Cys80 of two hArtemin molecules.
Structure
Activity Artemin supports the survival of different peripheral neurons and dopaminergic midbrain neurons both in vitro and in vivo. In addition, it supports motor neurons in culture1-3.
References-Activity
- Kotzbauer, P.T. et al. (1996) Nature 384, 467.
- Milbrandt, J. et al. (1998) Neuron 20, 245.
- Baloh, R.H. et al. (1998) Neuron 21, 1291.
Accession number Q5T4W7.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
Alomone Labs Recombinant human Artemin protein induces phosphorylation of PKB (Akt) kinase in SH-SY5Y cells.Cells were serum starved for 2 h and then stimunlated without and with 1 nM of Recombinant human Artemin protein (#RPA-100) for 8 min (lanes 1 and 2 respectively). Cell proteins were resolved by SDS-PAGE and probed with anti-phospho(Ser473)-Akt.
References - Scientific background
- Lucini, C. et al. (2004) Anat. Embryol. 208, 403.
Scientific background Artemin (ART), also named enovin and neublastin, is a neurotrophic factor that is crucial for the proper development of the sympathetic nervous system. ART belongs to the glial cell line-derived neurotrophic factor (GDNF) family of ligands, which also includes GDNF, neurturin (NRTN), and persephin (PSPN). Artemin mRNA is expressed in many human adult and fetal tissues and in rat Schwann cells. Artemin’s activity is mediated by a receptor complex composed of a receptor tyrosine kinase signaling component, RET, which is common for all GFLs, and a specific anchored membrane protein, GFRα3. Experimental studies have suggested that artemin supports the survival of cultured neurons from the dorsal root, trigeminal, nodose, and superior cervical ganglia and that it affects neurite outgrowth from the dorsal root and sympathetic ganglia of murine embryos. Recent investigations have reported that systemic artemin prevents and reverses neuropathic pain1.
Peptide Content: 100%
Lyophilized Powder
Recombinant human Artemin protein (#RPA-100) is a highly pure, recombinant, and biologically active protein.
For research purposes only, not for human use
Last Update: 07/05/2024
Applications
Citations
Citations
Powered by Bioz
