Overview
Alternative Name Glial Cell Line-Derived Neurotrophic Factor
Lyophilized Powder yes
Source Modified recombinant protein, E. coli
MW: 30.8 kDa (dimer)
Form Lyophilized from filtrated double distilled water (ddH2O). May contain TFA as a residual counter ion.
Effective concentration 1 nM – 0.1 µM
Sequence SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI-OH
Modifications LC-Biotin
Label LC-Biotin. The extent of labeling is 1-2 molecules of biotin per one recombinant human GDNF protein.
Structure
Activity GDNF enhances survival and differentiation of dopaminergic neurons. It is also a potent survival factor for motor neurons1-3.
References-Activity
- Lin, L.F. et al. (1993) Science 260, 1130.
- Lin, L.F. et al. (1994) J. Neurochem. 63, 758.
- Henderson, C.E. et al. (1995) Science 266, 1062.
Shipping and storage The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Solubility Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed.
For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeat freeze-thawing may result in loss of activity.
For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration of at least 0.1 mg/mL. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. It is recommended to prepare fresh solutions in working buffers just before use. Repeat freeze-thawing may result in loss of activity.
Storage of solutions Store the reconstituted solution for the shortest time possible at -20°C. We do not recommend storing the product in working solution for longer than one day. Avoid multiple freeze-thaw cycles.
Our bioassay
Live cell imaging of recombinant human GDNF-Biotin protein in live intact human SH-SY5Y cells.(A) CellMask™ Actin 1X solution was applied for 30 minutes at 370C, resulting in a green fluorescence to visualize cellular membrane. (B) Following this, the same cells underwent incubation with 0.1 µM of recombinant human GDNF protein-Biotin (#G-240-B) for 30 minutes at 370C, followed by Alexa Streptavidin-647, leading to red fluorescence. (C) Live imaging of SH-SY5Y cells allowed observation of GDNF distribution among the cells.
Live cell imaging of recombinant human GDNF-Biotin protein in live intact human SH-SY5Y cells.(A) CellMask™ Actin 1X solution was applied for 30 minutes at 370C, resulting in a green fluorescence to visualize cellular membrane. (B) Following this, the same cells underwent incubation with 0.1 µM of recombinant human GDNF protein-Biotin (#G-240-B) for 30 minutes at 370C, followed by Alexa Streptavidin-647, leading to red fluorescence. (C) Live imaging of SH-SY5Y cells allowed observation of GDNF distribution among the cells.
human GDNF-Biotin transport along the MN axons.human GDNF-Biotin (#G-240-B) is transported retrogradely in a MN explant grown in a microfluidic chamber. Representative images from a 10’ time lapse, taken roughly 2 hours after 50 ng/ml QDot-GDNF addition to distal axon compartment. Arrowheads point at transported particles. Live imaging was performed using a 60x objective with spinning disc confocal microscope, with a 2000ms interval between frames. Horizontal scale =10μm, vertical scale = 50 seconds.
Indirect flow cytometry of recombinant human GDNF protein in live intact human SH-SY5Y cells.___ SH-SY5Y cells.___ SH-SY5Y cells + 100 nM recombinant human GDNF protein-Biotin (#G-240-B) + 2 µg/ml Streptavidin, Alexa Fluor™ 647 conjugate.
___ SH-SY5Y cells + 100 nM recombinant human GDNF protein (#G-240) + 2 µg/ml Streptavidin, Alexa Fluor™ 647 conjugate.
___ SH-SY5Y cells + 2 µg/ml Streptavidin, Alexa Fluor™ 647 conjugate.
Recombinant human GDNF-Biotin protein induces ERK1/2 MAPK activation in SH-SY5Y cells.Cells were serum starved for 2 h and then stimulated with various concentrations of recombinant human GDNF-Biotin protein (#G-240-B) for 15 min. Cell proteins were resolved by SDS-PAGE and probed with anti-phospho-ERK1/2 (lower panel) and anti-ERK1/2 (upper panel).
References - Scientific background
- Airaksinen, M.S. Saarma, M. (2002) Nat. Rev. Neurosci. 3, 383.
- Henderson, C.E. et al. (1994) Science 266, 1062.
- Houenou, L.J. et al. (1996) Cell. Tissue Res. 286, 219.
- Kobayashi, M. and Matsuoka, I. (2000) Neuroreport 11, 2541.
- Tomac, A. et al. (1995) Nature 373, 335.
- Zhou, F.Q. et al. (2003) Cell 113, 814.
- Lin, L.F. et al. (1993) Science 260, 1130.
- Matheson, C.R. et al. (1997) Neuroreport 8, 1739.
- Brundin, P. (2002) Brain 125, 2149.
- Grondin, R. and Gash, D.M. (1998) J. Neurol. 245, P35.
Scientific background
Glial-derived neurotrophic factor (GDNF) is a member of the TGF-β superfamily. GDNF signals through a multi-component receptor system, composed of a RET proto-oncogene and one of the four α1-α4 receptors.1
GDNF promotes survival of various neuronal cells, including motoneurons,2,3 Purkinje cells and sympathetic neurons.4 In embryonic midbrain cultures, GDNF promotes the survival and morphological differentiation of dopaminergic neurons and increases their high-affinity DA uptake.5 Cells that express GDNF include Sertoli cells, type 1 astrocytes, Schwann cells,6 neurons, pinealocytes, and skeletal muscle cells.7
In vivo, following transection of facial motor neuron axons, locally applied GDNF has been shown to rescue virtually all damaged neurons from cell death.8 GDNF may be of clinical relevance in the treatment of Parkinson's disease that is characterized by progressive degeneration of midbrain dopaminergic neurons.9,10
Target GFRA1 (GDNFR-Alpha-1), RET Receptor Tyrosine Kinase
Lyophilized Powder
human GDNF-Biotin (#G-240-B) is a highly pure, recombinant, and biologically active conjugated protein.
Benefits of human GDNF-Biotin:
✓ Localization and distribution
✓ Live cell imaging
✓ Single cell detection
✓ Indirect flow cytometry
We gladly take on collaboration projects. Please Contact Us.
For research purposes only, not for human use
Last Update: 12/01/2025
Applications
Citations
Citations
Powered by Bioz
