Name: Jingzhaotoxin-34
Brand: Alomone Labs
SKU: STJ-500

Overview

Cat #: STJ-500

Alternative Name Mu-theraphotoxin-Cg1a, Mu-TRTX-Cg1a, JZTX-34, Peptide F6-25.51

Lyophilized Powder yes

Origin Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys jingzhao)

Source Synthetic peptide

MW: 4150.7 Da

Purity: >98% (HPLC)

Form Lyophilized Powder

Effective concentration 50 nM - 0.5 µM

Sequence ACREWLGGCSKDADCCAHLECRKKWPYHCVWDWTV-OH

Modifications Disulfide bonds location - Cys^2-16, Cys^9-21and Cys^15-29

Structure

Molecular formula C₁₈₂H₂₅₈N₅₂O₄₉S₆

Activity JzTx-34 activates hNa_v1.1, hNa_v1.3 and hNav1.6. The peptide also blocks hNa_v1.2, Na_v1.5, Na_v1.7 and hERG channels, and mildly inhibits hNa_v1.4¹. JZTX-34 shows analgesic activity in rodent pain models. In addition, this toxin inhibits voltage-gated potassium channels (K_v) in rat DRG neurons².

References-Activity

Lopes, L. et al. (2023) Biomed Pharmacother., 165, 115173.
Zeng, X. et al. (2018) Toxins, 10, 64.

Accession number B1P1F7

Shipping and storage The product is shipped as a lyophilized powder at room temperature. Upon receipt, it should be stored at -20°C. Protect from moisture.

Solubility Soluble in water. For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in ddH2O at a concentration X100-1000 of final working solution. Divide the solution into small aliquots and store at -20°C. Upon use, thaw the relevant vial intended for use and dilute in your desired working buffer. The preparation of fresh solutions in working buffers before use is recommended. Centrifuge all product preparations before use (10000 x g, 5 min). Repeat freeze-thawing might result in a loss of activity.

Storage of solutions The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the toxin in working solutions for longer than a few days. Avoid multiple freeze- thaw cycles.

Our bioassay

Alomone Labs Jingzhaotoxin-34 inhibits Na_V1.7 channel currents heterologously expressed in Xenopus oocytes.
A. Representative time course of Jingzhaotoxin-34 (#STJ-500) inhibition of Na_V1.7 channels current. Membrane potential was held at -80 mV, current was elicited by a 100 ms voltage step to 0 mV every 10 sec, and significantly inhibited by application of 0.5 µM Jingzhaotoxin-34 (green).
B. Superimposed traces of Na_V1.7 channel currents in the absence (control) and presence (green) of 0.5 µM Jingzhaotoxin-34 (taken from the recording in A).
Alomone Labs Jingzhaotoxin-34 enhances the current of Na_V1.1 channels heterologously expressed in Xenopus oocytes.
A. Representative time course of Jingzhaotoxin-34 (#STJ-500) effect on the normalized area of Na_V1.1 channels current. Membrane potential was held at -80 mV and current was elicited by a 100 ms voltage step to 0 mV, applied every 10 sec. 0.5 µM Jingzhaotoxin-34 (green) were perfused as indicated by the horizontal bar. B. Superimposed traces of Na_V1.1 current after application of control (black) and of 0.5 µM Jingzhaotoxin-34 (green), taken from the recording in A.

References - Scientific background

Chen, J. et al. (2008) Cell. Mol. Life Sci., 65, 2431.
Chen J. et al. (2009) Peptides, 30, 1042.
Zeng, X. et al. (2018) Toxins, 10, 64.
Lopes, L. et al. (2023) Biomed Pharmacother., 165, 115173.
Laedermann, C.J. et al. (2015) Front. Pharmacol., 6, 263.

Scientific background

Jingzhaotoxin-34 (JZTX-34) is a 35 amino acid peptidyl toxin, originally isolated from the venom of the Chinese earth tiger tarantula, Chilobrachys guangxiensis^1,2.

JzTx-34 was reported first as a potent and selective blocker of the voltage-gated sodium (Na_V) 1.7 channel and a weak blocker of the Na_v1.3 channel³. Recently, it has been found that JzTx-34 has more potent activity as an activator of hNa_v1.1⁴. In addition, at higher concentrations than hNa_v1.1, this toxin activated hNa_v1.3 and hNa_v1.6 channels and also blocked hNa_v1.2, hNa_v1.4, hNa_v1.5, hNa_v1.7, and hERG channels⁴. Moreover, JzTx-34 inhibited voltage-gated potassium (K_v) channels in rat DRG neurons³.

Na_v channels are transmembrane proteins that control the voltage-dependent increase in sodium permeability. They play a fundamental role in normal neurological function, especially in the initiation and propagation of action potentials. Na_V1.1 channel has been utilized as a therapeutic target for various brain disorders, including epilepsy, Alzheimer's disease, and autism. The Na_V1.1 channel also contributes to mechanical pain by regulating the excitability of a specific subset of sensory neurons within the peripheral nervous system. Several studies, including the analysis of mutations associated with an increase or absence of pain sensitivity in humans, have revealed that Na_v1.7, Na_v1.8, and Na_v1.9 are the most important contributors that control nociceptive neuronal electrogenesis⁵. JZTX-34 exhibited analgesic activity in three rodent pain models³.

Target hNa_v1.1 activator, Na_v1.7 blocker

Peptide Content: 100%

Lyophilized Powder

Jingzhaotoxin-34 (#STJ-500) is a highly pure, synthetic, and biologically active peptide toxin.

Certificate of Analysis SDS

For research purposes only, not for human use

Last Update: 07/05/2024

Navigation

Order Summary

Jingzhaotoxin-34

Overview

Applications

Citations

Specifications

Scientific Background

Need Help With This Product?