Overview
Type: GST fusion protein
Form: Lyophilized powder
KCNH2/HERG Blocking Peptide (#BLP-PC062) is the original antigen used for immunization during Anti-KCNH2 (HERG) Antibody (#APC-062) generation. The blocking peptide binds and ‘blocks’ Anti-KCNH2/HERG primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.
Applications: wb, ihc
For research purposes only. not for human use
Applications
Demonstration of Pre-adsorption control
Western blot analysis of KV11.1 (HERG)-expressing HEK-293 cells:1. Anti-KCNH2 (HERG) Antibody (#APC-062), (1:400).
2. Anti-KCNH2 (HERG) Antibody, preincubated with KCNH2/HERG Blocking Peptide (#BLP-PC062).- Mouse frozen heart sections (1:300) (Teng, G.Q. et al. (2008) Circ. Res. 103, 1483.).
Properties
Sequence
- GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human KV11.1 (HERG) (Accession Q12809).
Accession (Uniprot) Number Q12809
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 μl PBS.
Storage After Reconstitution -20°C.
Standard Quality Control Of Each Lot Western blot analysis.
