Overview
Type: GST fusion protein
Form: Lyophilized powder
KCNJ1/Kir1.1 Blocking Peptide (#BLP-PC001) is the original antigen used for immunization during Anti-KCNJ1 (Kir1.1) Antibody (#APC-001) generation. The blocking peptide binds and ‘blocks’ Anti-KCNJ1/Kir1.1 primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.
Applications: wb, ihc
For research purposes only. not for human use
Applications
Demonstration of Pre-adsorption control
Western blot analysis of rat kidney membranes:1. Anti-KCNJ1 (Kir1.1) Antibody (#APC-001), (1:200).
2. Anti-KCNJ1 (Kir1.1) Antibody, preincubated with KCNJ1/Kir1.1 Blocking Peptide (#BLP-PC001).
Expression of KCNJ1 in rat kidneyImmunohistochemical staining of rat kidney sections using Anti-KCNJ1 (Kir1.1) Antibody (#APC-001), (left). There is strong staining (red) of tubular epithelial cells in distal tubes. Note that no staining is observed in proximal tubules (arrow). Counterstain of cell nuclei appears blue. A negative control is shown (right).
Properties
Sequence
- GST fusion protein with the sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat KCNJ1 (Accession P35560).
Accession (Uniprot) Number P35560
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 μl PBS.
Concentration After Reconstitution 0.4 mg/ml.
Storage After Reconstitution -20°C.
Antigen Preadsorption Control 3 μg fusion protein per 1 μg antibody.
Standard Quality Control Of Each Lot Western blot analysis.
