Size: 0.12 mg
Type: GST fusion protein
Form: Lyophilized powder
Applications: wb, ihc
For research purposes only. not for human use
Properties
Sequence
- GST fusion protein with the sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat KCNJ1 (Accession P35560).
Accession (Uniprot) Number P35560
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 μl PBS.
Concentration After Reconstitution 0.4 mg/ml.
Storage After Reconstitution -20°C.
Antigen Preadsorption Control 3 μg fusion protein per 1 μg antibody.
Standard Quality Control Of Each Lot Western blot analysis.
Applications
Demonstration of Pre-adsorption control
Western blot analysis of rat kidney membranes:1. Anti-KCNJ1 (Kir1.1) Antibody (#APC-001), (1:200).
2. Anti-KCNJ1 (Kir1.1) Antibody, preincubated with KCNJ1/Kir1.1 Blocking Peptide (#BLP-PC001).- Rat kidney sections (see also 2 in recent publications using this product).
Last update: 02/01/2024
