Free shipping starts now, no minimum!

Certificate of Analysis

KV1.2 (KCNA2) Channel Deluxe Research Pack

All You Need for KV1.2 (KCNA2) Channel Research

Cat #: ESD-500_PACK
Size: 9 Vials
Form: Lyophilized

Antibodies

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Anti-KV1.2 (KCNA2) Antibody Cat #: APC-010

Size: 0.2 ml Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 of rat KV1.2 (Accession P63142). Intracellular, C-terminus.
Homology
Mouse, dog, human, - identical.

Anti-KV1.2 (KCNA2) (extracellular) Antibody Cat #: APC-162

Size: 0.2 ml Host: Rabbit Type: Polyclonal Application: IC, IF, LCI, WB Reactivity: M, R
Immunogen
Peptide (C)RDENEDMHGGGVT, corresponding to amino acid residues 189-201 of rat KV1.2 (Accession P63142). 1st extracellular loop.
Homology
Mouse - identical; human - 12/13 amino acid residues identical.

Pharmacological Reagents

κ-Conotoxin RIIIJ Cat #: STC-660

Size: 0.5 mg MW: 2807.9 Da Purity: >98% (HPLC) Net peptide content: 100%
Origin
Synthetic peptide
Effective concentration
30 nM.
Activity
κ-Conotoxin RIIIJ is a blocker of KV1.2 channels1.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution
Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
Up to two weeks at 4°C or three months at -20°C.

Dendrotoxin-K Cat #: D-400

Size: 70 µg MW: 6560 Da Purity: >99% (HPLC) Net peptide content: 100%
Origin
Natural peptide isolated from Dendroaspis polylepis polylepis (Black mamba).
Effective concentration
100 nM
Activity
Dendrotoxin-K is a highly selective and potent blocker of voltage-gated Kchannels KV1.1 and Kv1.1-containing heterooligomer.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution
Any aqueous buffer (pH 7.5). Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
One week at 4°C or six months at -20°C.

MCD peptide Cat #: STM-250

Size: 1 mg MW: 2588 Da Purity: >98% (HPLC) Net peptide content: 100%
Origin
Synthetic peptide
Effective concentration
10 nM - 1 μM.
Activity
MCD peptide inhibits KV1.1 and KV1.2 channels1,2.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution
Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
Up to four weeks at 4°C or six months at -20°C.

Tityustoxin-Kα Cat #: STT-360

Size: 0.5 mg MW: 3942 Da Purity: >99% (HPLC) Net peptide content: 100%
Origin
Synthetic peptide
Effective concentration
0.5 - 50 nM.
Activity
Tityustoxin-Kα blocks cloned KV1.2 with high potency1.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution
Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
Up to two weeks at 4°C or three months at -20°C.

Tityustoxin-Kα-ATTO Fluor-594 Cat #: STT-360-AR

Size: 5 µg MW: ~4900 Da Purity: >98% (HPLC) Net peptide content: 100%
Origin
Synthetic peptide
Effective concentration
0.5-50 nM.
Activity
Tityustoxin-Kα blocks cloned KV1.2 with high potency1,2.
Using Alomone labs Tityustoxin-Kα-ATTO Fluor-594 in microscopy technique, Williams R.W. et al. showed recently that stimulating adenylate cyclase (AC) decreased surface KV1.2 within the pinceaus of cerebellar basket cell (BC) axon terminals3.
Storage before reconstitution
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. Avoid exposure to light.
 
Reconstitution
The product is lyophilized in 0.5 ml conical vial.
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes). The lyophilizate may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed.
Soluble in pure water at high-micromolar concentrations (50 µM - 1 mM). For long-term storage in solution, it is recommended to prepare a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations at 10,000 x g for 5 minutes before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.
Storage after reconstitution
Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light.
 

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Reconstitution

Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution

-20ºC.

Preadsorption control

1 μg peptide per 1 μg antibody.

For more information, please refer to individual certificate of analysis for each product.
Note

KV1.2 (KCNA2) Channel Overexpressed Membrane Fractions includes:
1 x 0.1 ml lyophilized KV1.2 channel overexpressed membrane fractions
1 x 0.1 ml lyophilized non-injected Xenopus oocyte membrane fractions

For research purposes only, not for human use