Cat #: ESD-500_PACK
Size: 9 Vials
Form: Lyophilized
Antibodies
Application key:
CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot
Species reactivity key:
H- Human, M- Mouse, R- Rat
Anti-KV1.2 (KCNA2) Antibody Cat #: APC-010
Size:
0.2 ml
Host: Rabbit
Type: Polyclonal
Application:
IC, IF, IH, WB
Reactivity:
H, M, R
Immunogen
GST fusion protein with the sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 of rat KV1.2 (Accession P63142). Intracellular, C-terminus.
Homology
Mouse, dog, human, - identical.
Anti-KV1.2 (KCNA2) (extracellular) Antibody Cat #: APC-162
Size:
0.2 ml
Host: Rabbit
Type: Polyclonal
Application:
IC, IF, LCI, WB
Reactivity:
M, R
Immunogen
Peptide (C)RDENEDMHGGGVT, corresponding to amino acid residues 189-201 of rat KV1.2 (Accession P63142). 1st extracellular loop.
Homology
Mouse - identical; human - 12/13 amino acid residues identical.
Pharmacological Reagents
κ-Conotoxin RIIIJ Cat #: STC-660
Size:
0.5 mg
MW: 2807.9 Da
Purity: >98% (HPLC)
Net peptide content: 100%
Origin
Synthetic peptide
Effective concentration
30 nM.
Activity
κ-Conotoxin RIIIJ is a blocker of KV1.2 channels1.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution
Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
Up to two weeks at 4°C or three months at -20°C.
Dendrotoxin-K Cat #: D-400
Size:
70 µg
MW: 6560 Da
Purity: >99% (HPLC)
Net peptide content: 100%
Origin
Natural peptide isolated from Dendroaspis polylepis polylepis (Black mamba).
Effective concentration
100 nM
Activity
Dendrotoxin-K is a highly selective and potent blocker of voltage-gated K+ channels KV1.1 and Kv1.1-containing heterooligomer.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution
Any aqueous buffer (pH 7.5). Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
One week at 4°C or six months at -20°C.
MCD peptide Cat #: STM-250
Size:
1 mg
MW: 2588 Da
Purity: >98% (HPLC)
Net peptide content: 100%
Origin
Synthetic peptide
Effective concentration
10 nM - 1 μM.
Activity
MCD peptide inhibits KV1.1 and KV1.2 channels1,2.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution
Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
Up to four weeks at 4°C or six months at -20°C.
Tityustoxin-Kα Cat #: STT-360
Size:
0.5 mg
MW: 3942 Da
Purity: >99% (HPLC)
Net peptide content: 100%
Origin
Synthetic peptide
Effective concentration
0.5 - 50 nM.
Activity
Tityustoxin-Kα blocks cloned KV1.2 with high potency1.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution
Any other aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage after reconstitution
Up to two weeks at 4°C or three months at -20°C.
Tityustoxin-Kα-ATTO Fluor-594 Cat #: STT-360-AR
Size:
5 µg
MW: ~4900 Da
Purity: >98% (HPLC)
Net peptide content: 100%
Origin
Synthetic peptide
Effective concentration
0.5-50 nM.
Activity
Tityustoxin-Kα blocks cloned KV1.2 with high potency1,2.
Using Alomone labs Tityustoxin-Kα-ATTO Fluor-594 in microscopy technique, Williams R.W. et al. showed recently that stimulating adenylate cyclase (AC) decreased surface KV1.2 within the pinceaus of cerebellar basket cell (BC) axon terminals3.
Using Alomone labs Tityustoxin-Kα-ATTO Fluor-594 in microscopy technique, Williams R.W. et al. showed recently that stimulating adenylate cyclase (AC) decreased surface KV1.2 within the pinceaus of cerebellar basket cell (BC) axon terminals3.
Storage before reconstitution
Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. Avoid exposure to light.
Reconstitution
Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min). Avoid exposure to light. The product is lyophilized in 0.5 ml conical vial.
Storage after reconstitution
Up to two weeks at 4°C or three months at -20°C. Avoid exposure to light.
Antibody Storage & Reconstitution Instructions
Storage before reconstitution
Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Reconstitution
Add deionized water, depending on the sample size.
Storage after reconstitution
The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).
Control antigen storage before reconstitution
Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Control antigen reconstitution
100 μl water.
Control antigen storage after reconstitution
-20ºC.
Preadsorption control
1 μg peptide per 1 μg antibody.
For more information, please refer to individual certificate of analysis for each product.
Note
KV1.2 (KCNA2) Channel Overexpressed Membrane Fractions includes:
1 x 0.1 ml lyophilized KV1.2 channel overexpressed membrane fractions
1 x 0.1 ml lyophilized non-injected Xenopus oocyte membrane fractions
For research purposes only, not for human use
