Size: 0.12 mg
Type: GST fusion protein
Form: Lyophilized powder
Applications: wb, ihc
For research purposes only. not for human use
Properties
Sequence
- GST fusion protein with the sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 of rat KV1.2 (Accession P63142).
Accession (Uniprot) Number P63142
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 μl PBS.
Storage After Reconstitution -20°C.
Antigen Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Standard Quality Control Of Each Lot Western blot analysis.
Applications
Demonstration of Pre-adsorption control
Western blot analysis of rat brain membranes:1. Anti-KV1.2 (KCNA2) Antibody (#APC-010), (1:200).
2. Anti-KV1.2 (KCNA2) Antibody, preincubated with Kv1.2/KCNA2 Blocking Peptide (#BLP-PC010).
Western blot analysis of rat heart membranes:1. Anti-KV1.2 (KCNA2) Antibody (#APC-010), (1:200)
2. Anti-KV1.2 (KCNA2) Antibody, preincubated with Kv1.2/KCNA2 Blocking Peptide (#BLP-PC010).- Rat and mouse brain sections brain sections (1:300).
Mouse cerebellum (1:350) (Kleopa, K.A. et al. (2006) Brain 129, 1570.).
Last update: 02/01/2024
