Cat #: BLP-PC002
Size: 0.12 mg
Type: GST fusion protein
Form: Lyophilized powder
Applications: wb, ihc
Application key:
WB- Western blot, IHC- Immunohistochemistry
For research purposes only. not for human use
Properties
Sequence
- GST fusion protein with the sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human KV1.3 (Accession P22001).
Accession (Uniprot) Number P22001
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 μl PBS.
Storage After Reconstitution -20°C.
Antigen Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Standard Quality Control Of Each Lot Western blot analysis.
Applications
Demonstration of Pre-adsorption control
- Western blot analysis of rat brain membranes:1. Anti-KV1.3 (KCNA3) Antibody (#APC-002), (1:200).
2. Anti-KV1.3 (KCNA3) Antibody, preincubated with Kv1.3/KCNA3 Blocking Peptide (#BLP-PC002). - Rat brain sections.
Last update: 08/01/2025