Size: 0.12 mg
Type: GST fusion protein
Form: Lyophilized powder
Applications: wb, ihc
For research purposes only. not for human use
Properties
Sequence
- GST fusion protein with the sequence PYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCGKEEKCQGKGDDSETDKNNCSNAKAVETDV, corresponding to amino acid residues 589-655 of rat KV1.4 (Accession P15385).
Accession (Uniprot) Number P15385
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 μl PBS.
Storage After Reconstitution -20°C.
Antigen Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Standard Quality Control Of Each Lot Western blot analysis.
Applications
Demonstration of Pre-adsorption control
Western blot analysis of rat brain membranes:1. Anti-KV1.4 Antibody (#APC-007), (1:200).
2. Anti-KV1.4 Antibody, preincubated with Kv1.4 Blocking Peptide (#BLP-PC007).- Rat brain sections (see also references 7-9 in publications using this product).
Last update: 02/01/2024
