Overview
Cat #: BLP-PC003
Type: GST fusion protein
Form: Lyophilized powder
Kv1.6/KCNA6 Blocking Peptide (#BLP-PC003) is the original antigen used for immunization during Anti-KV1.6 (KCNA6) Antibody (#APC-003) generation. The blocking peptide binds and ‘blocks’ Anti-Kv1.6/KCNA6 primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.
Applications: wb, ihc
Application key:
WB- Western blot, IHC- Immunohistochemistry
For research purposes only. not for human use
Applications
Demonstration of Pre-adsorption control
- Western blot analysis of rat brain membranes:1. Anti-KV1.6 (KCNA6) Antibody (#APC-003), (1:200).
2. Anti-KV1.6 (KCNA6) Antibody, preincubated with Kv1.6/KCNA6 Blocking Peptide (#BLP-PC003). - Rat brain sections (see also 1,2 in publications using this product). Mouse cerebellum (1:350) (Kleopa, K.A. et al. (2006) Brain 129, 1570.).
Properties
Sequence
- GST fusion protein with the sequence NYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEASRERRSSYLPTPHRAYAEKRMLTEV, corresponding to amino acid residues 463-530 of rat KV1.6 (Accession P17659).
Accession (Uniprot) Number P17659
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 μl PBS.
Concentration After Reconstitution 0.4 mg/ml.
Storage After Reconstitution -20°C.
Antigen Preadsorption Control 3 µg fusion protein per 1 µg antibody.
Standard Quality Control Of Each Lot Western blot analysis.