Overview
Cat #:
RTL-550
Alternative Name K+ channel toxin α-KTx 1.2, Charybdotoxin-2, ChTX-Lq2, ChTx-d, Toxin 18-2, Lqh 18-2
Lyophilized Powder yes
Origin Recombinant, E. coli
MW: 4353 Da
Purity: >98% (HPLC)
Effective concentration 0.1-10 nM.
Sequence QFTQESCTASNQCWSICKRLHNTNRGKCMNKKCRCYS.
Modifications Disulfide bonds between Cys7-Cys28, Cys13-Cys33 and Cys17-Cys35.
Structure
Molecular formula C177H280N60O55S7.
Activity Lq2 inhibits Kir1.1 K+ inward rectifier channels2, as well as KCa channels1.
References-Activity
- Lucchesi, K. et al. (1989) J. Membr. Biol. 109, 269.
- Lu, Z. and MacKinnon, R. (1997) Biochemistry 36, 6936.
Accession number
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
- Alomone Labs Lq2 inhibits Kir1.1 (ROMK1) channels heterologously expressed in Xenopus oocytes.A. ROMK1 channel current (in 5 mM K+) elicited by 200 ms depolarization from a holding potential of -100 mV to +20 mV, before and during application of Lq2 (#RTL-550) at the indicated concentrations. B. Mean ±S.D. dose response for Lq2 inhibition of ROMK1 channels (n = 4-6 oocytes for each time point). The smooth line is a fit giving a Ki of 5 nM. C. Mean ± S.D. I-V relation of control and inhibited currents (n = 4).
References - Scientific background
- Lucchesi, K. et al. (1989) J. Membr. Biol. 109, 269.
- Lu, Z. and MacKinnon, R. (1997) Biochemistry 36, 6936.
Scientific background
Lq2 was originally isolated from Leiurus quinquestriatus hebraeus scorpion venom.1
Lq2 blocks Kir1.1 K+ inward rectifier channels (Ki of 410 nM).2
In the planar lipid bilayer, it also blocked single KCa channels from rat muscle with intrinsic KD of 43 nM,1 by introducing brief closures. Lq2 action is on the extracellular side of the pore.
Target Kir1.1 K+ channels
Peptide Content: 100%
Lyophilized Powder
Lq2 (#RTL-550) is a highly pure, recombinant, and biologically active peptide toxin.
For research purposes only, not for human use
Last Update: 08/01/2025
Applications
Citations
Citations
Product citations
- Meneses, D. et al. (2015) Synapse. 69, 446.