Overview
Alternative Name Potassium channel toxin α-KTx 2.2, MgTX-theraphotoxin-Hh2a, MgTX
Lyophilized Powder yes
Origin Synthetic peptide
MW: 4179 Da
Purity: >98% (HPLC)
Effective concentration 50 pM - 50 nM.
Sequence TIINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH.
Modifications Disulfide bonds between Cys7-Cys29, Cys13-Cys34, and Cys17-Cys36.
Structure
Molecular formula C178H286N52O50S7.
CAS No.: 145808-47-5
Activity Margatoxin is a blocker of KV1.3 and KV1.6 channels.
Accession number P40755.
Shipping and storage The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the products at -20°C. Protect from moisture.
Solubility Soluble in water. Centrifuge all product preparations before use (10000 x g, 5 min). For long-term storage in solution, we highly recommend preparing a stock solution in pure water (e.g., double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the solution into small aliquots and store at -20°C. Upon use, thaw the relevant vial and dilute in your working buffer. The preparation of fresh solutions in working buffers before use is recommended. Avoid multiple freeze-thaw cycles to maintain biological activity. Centrifuge all product preparations before use (10000 x g, 5 min).
Storage of solutions The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Our bioassay
Alomone Labs Margatoxin inhibits KV1.3 currents expressed in Xenopus oocytes.A. Time course of Margatoxin (#STM-325) action on Kv1.3 currents. Current amplitudes were plotted as a function of time. Membrane potential was held at –100 mV and oocytes were stimulated by a 100 ms voltage ramp to +60 mV. 0.5 nM Margatoxin were perfused as indicated by the bar (green) at + 55 mV for 180 sec. B. Superimposed examples of KV1.3 channel current in the absence (control) and presence (green) of 0.5 nM Margatoxin (taken from the experiment in A).
Scientific background Margatoxin is a peptidyl toxin originally isolated from the scorpion Centruroides margaritatus. It is a specific blocker of KV1.3 channels (IC50~30 pM), but it also blocks KV1.6 and a splice variant of the Drosophila Shaker channels with IC50 of 5 and 150 nM respectively.2 In Xenopus oocytes the toxin is less potent and inhibits expressed KV1.3 channels with an apparent IC50 of ~1 nM.2
Target KV1.3, KV1.6 K+ channels
Peptide Content: 100%
Lyophilized Powder
Image & Title 
Alomone Labs Margatoxin blocks KV1.3 channel currents in Jurkat cells and human peripheral blood T cells.Current traces were elicited by 300 ms depolarizing pulses from a holding potential of -80 mV, with 10 mV steps. A. In Jurkat cells. B. In human peripheral blood T cells (PBTC). C. application of 10 nM Margatoxin (#STM-325) nearly completely abolishes currents, confirming that KV1.3 currents are the predominant component of the outward current in Jurkats cells and PTBCs.Adapted from Zhao, N. et al. (2013) PLoS ONE 8, e64629. with permission of PLoS.
Alomone Labs Margatoxin blocks KV1.3 channel currents in Jurkat cells and human peripheral blood T cells.Current traces were elicited by 300 ms depolarizing pulses from a holding potential of -80 mV, with 10 mV steps. A. In Jurkat cells. B. In human peripheral blood T cells (PBTC). C. application of 10 nM Margatoxin (#STM-325) nearly completely abolishes currents, confirming that KV1.3 currents are the predominant component of the outward current in Jurkats cells and PTBCs.Adapted from Zhao, N. et al. (2013) PLoS ONE 8, e64629. with permission of PLoS.
For research purposes only, not for human use
Last Update: 07/08/2024
Specifications
Citations
Citations
