Overview
QIRPAFCYEDPPFFQKCGAFVDSYYFNRSRITCVHFFYGQCDVNQNHFTTMSECNRVCHG.
MitTx-β subunit:
NLNQFRLMIKCTNDRVWADFVDYGCYCVARDSNTPVDDLDRCCQAQKQCYDEAVKVHGCKPLVMFYSFECRYLASDLDCSGNNTKCRNFVCNCDRTATLCILTATYNRNNHKIDPSRCQ.
- Bohlen, C.J. et al. (2011) Nature 479, 410.
- Bohlen, C.J. and Julius, D. (2012) Toxicon 60, 254.
Alomone Labs alpha/beta (1:1) MitTx Toxin activates ASIC1a channels expressed in Xenopus oocytes.Membrane potential was held at -80mV. ASIC1a channels current was elicited every 50 sec by transient pH 5.5 stimulation (arrows) or activated by a 3 min application of 50 nM MitTx Toxin (#M-100), as indicated.
- Bohlen, C.J. et al. (2011) Nature 479, 410.
- Bohlen, C.J. and Julius, D. (2012) Toxicon 60, 254.
alpha/beta MitTx (MitTx toxin) is a natural toxin isolated from the Texas Coral snake venom1. The purified active toxin consists of a heteromeric complex between Kunitz (α subunit) and phospholipase-A2-like (β subunit) proteins that together function as a potent, persistent and selective agonist for acid-sensing ion channels (ASICs), showing equal or greater efficacy compared with acidic pH1.
MitTx-α and MitTx-β form a high affinity 1:1 complex, and neither subunit demonstrates functional effects on its own1,2.
The purified ASIC-activating component of the venom, MitTx, was found to be sufficient to elicit robust nocifensive behaviors and is likely responsible for the lasting pain experienced by victims of coral snake envenomation2.
MitTx Toxin (#M-100) is a highly pure, natural, and biologically active peptide toxin.
Applications
Citations
Powered by Bioz- Xenopus oocytes expressing ASIC1 (two electrode voltage clamp).
Barth, D. and Fronius, M. (2019) Sci. Rep. 9, 6781.
