Overview
Cat #:
STG-450
Alternative Name Omega-theraphotoxin-Gr1a, ω-TRTX-Gr1a, ω-GrTx SIA, ω-GsTx SIA, Omega-GTX SIA
Lyophilized Powder yes
Origin Grammostola rosea (Chilean rose tarantula).
Source Synthetic peptide
MW: 4109.7 Da
Purity: ≥98%
Form Lyophilized Powder
Effective concentration 50-500 nM.
Sequence DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV- NH2
Modifications Disulfide bonds between Cys2-Cys16, Cys9-Cys21, and Cys15-Cys30.
V36 - Valine amide.
Molecular formula C177H263N53O49S6
CAS No.: 152617-90-8
Activity ω-Grammotoxin SIA is a potent inhibitor of both P- and N-type Ca2+ channels1.
Shipping and storage The product is shipped as a lyophilized powder at room temperature. Upon receipt, it should be stored at -20°C. Protect from moisture.
Solubility Soluble in water. For long-term storage in solution, we recommend to prepare a stock solution by dissolving the product in ddH2O at a concentration X100-1000 of final working solution. Divide the solution into small aliquots and store at -20°C. Upon use, thaw the relevant vial intended for use and dilute in your desired working buffer. Centrifuge all product preparations before use (10000 x g, 5 min). Repeat freeze-thawing might result in loss of activity. [It is recommended to prepare working solutions fresh before use].
Storage of solutions The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the toxin in working solutions for longer than a few days. Avoid multiple freeze- thaw cycles.
Scientific background ω-Grammotoxin SIA is a 36 amino acid peptidyl toxin originally isolated from the venom of the South American Tarantula spider, Grammostola spatulata. ω-Grammotoxin SIA potently inhibits both CaV2.1 (P-type) and CaV2.2 (N-type) Ca2+ channels by altering the voltage-dependence of channel gating. ω-Grammotoxin SIA caused a concentration-dependent and virtually complete inhibition of K+-evoked influx of 45Ca2+ into either rat or chick brain synaptosomes.1 ω-Grammotoxin SIA at 1 µM, a maximally effective concentration, blocked 52% of IBa in cultured rat hippocampal neurons.2 A concentration of >50 nM toxin completely inhibited Ca2+ currents in Purkinje neurons (predominantly, P-type channels) and in sympathetic neurons (predominantly, N-type channels).3
Target P-type and N-type Ca2+ channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 07/05/2024
