Overview
OsK-1 Toxin (#STO-150) is a highly pure, synthetic, and biologically active peptide toxin.
Alternative Name K+ channel toxin α-KTx 3.7, OsK1
Structure
For research purposes only, not for human use
Applications
Citations (5)
Citations
Powered by BiozElectrophysiology
- Human CD4 T-cells (10-100 pM).
Fung-Leung, W.P. et al. (2017) PLoS ONE 12, e0170102.
Product citations
- Fulton, S. et al. (2011) J. Biol. Chem. 286, 9360.
Specifications
Properties
Technical Specifications
Origin Synthetic peptide
MW 4205 Da
Sequence GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK.
Modifications Disulfide bonds between Cys8-Cys28, Cys14-Cys33 and Cys18-Cys35.
Peptide Content 100%
Purity >98% (HPLC)
Molecular formula C177H300N56O46S8.
Form Lyophilized powder.
Accession number P55896.
Biological Activity
Target KV1.1, KV1.2, KV1.3, and KCa3.1 K+ channels
Effective concentration 5-100 nM.
Activity OsK-1 inhibits KV1.1, KV1.2, KV1.3 channels potently and KCa3.1 channel moderately1.
References
- Mouhat, S. et al. (2005) Biochem. J. 385, 95.
Solubility and Storage
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer.
Storage of solutions Up to one week at 4°C or three months at -20°C.
Scientific Background
References
Scientific background OsK1 (α-KTx3.7) is a 38-residue toxin cross-linked by three disulphide bridges, originally isolated from the venom of the Asian scorpion Orthochirus scrobiculosus.1 The toxin was found to block a number of K+ channels, both voltage-dependent and Ca2+-activated isoforms. OsK-1 is lethal in mice by intracerebroventricular injection, with a LD50 value of 2 mg/kg. OsK-1 blocks mKV1.1, mKV1.2, mKV1.3 channels potently and hKCa3.1 channel moderately, with IC50 values of 0.6, 5.4, 0.014 and 225 nM, respectively.2 No inhibition effects were observed on KV1.4, KV1.5, KV1.6, KV1.7, KV11, KCa2.1, KCa2.2, KCa2.3 and KCa1.1 channels at µM concentrations.2
References
- Grishin, E.V. et al. (1996) Pure Appl. Chem. 68, 2105.
- Mouhat, S. et al. (2005) Biochem. J. 385, 95.
- Jaravine, V.A. et al. (1997) Biochemistry 36, 1223.
Last Update: 08/01/2025
