Free shipping starts now, no minimum!

Certificate of Analysis

Pacemaker Cell Marker Antibody Kit

A Screening Package of Antibodies to SAN Expressing Proteins Economically Priced

Cat #: AK-620_KIT
Size: 22 Vials
Form: Lyophilized

Application key:

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Species reactivity key:

H- Human, M- Mouse, R- Rat

Guinea pig Anti-HCN1 Antibody Cat #: APC-056-GP

Size: 50 µl Host: Guinea pig Type: Polyclonal Application: IF, IH, WB Reactivity: R
Immunogen
Peptide (C)KPNSASNSRDDGNSVYPSK, corresponding to amino acid residues 6-24 of rat HCN1 (Accession Q9JKB0). Intracellular, N-terminus.
Homology
Mouse - 18/19 amino acid residues identical; human - 16/19 amino acid residues identical.

HCN1 Blocking Peptide Cat #: BLP-PC056

Size: 40 µg

Guinea pig Anti-HCN4 Antibody Cat #: APC-052-GP

Size: 50 µl Host: Guinea pig Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence HGHLHDSAEE RRLIAEGDASPGEDRTPPGLAAEPERP, corresponding to amino acid residues 119-155 of human HCN4 (Accession Q9Y3Q4). Intracellular, N-terminus.
Homology
Rabbit - identical; rat - 35/37 amino acid residues identical; mouse - 33/37 amino acid residues identical.

HCN4 Blocking Peptide Cat #: BLP-PC052

Size: 0.15 mg

Anti-Connexin-32 Antibody Cat #: ACC-211

Size: 50 µl Host: Rabbit Type: Polyclonal Application: WB Reactivity: H, M, R
Immunogen
Peptide (C)EINKLLSEQDGSLK, corresponding to amino acid residues 247-260 of rat Connexin-32 (Accession P08033). Intracellular, C-terminus.
Homology
Human, mouse – identical.

Connexin-32 Blocking Peptide Cat #: BLP-CC211

Size: 40 µg

Anti-Connexin-45 (GJC1) Antibody Cat #: ACC-207

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)KEQSQPKPKHDGRR, corresponding to amino acid residues 153-166 of rat Connexin-45 (Accession A4GG66). Intracellular loop.
Homology
Mouse, human - identical.

Connexin-45/GJC1 Blocking Peptide Cat #: BLP-CC207

Size: 40 µg

Guinea pig Anti-CaV1.3 (CACNA1D) Antibody Cat #: ACC-005-GP

Size: 50 µl Host: Guinea pig Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)DNKVTIDDYQEEAEDKD, corresponding to amino acid residues 859-875 of rat CaV1.3 (Accession P27732). Intracellular loop between domains II and III.
Homology
Mouse - 16/17 amino acid residues identical; human -15/17 amino acid residues identical.

Cav1.3/CACNA1D Blocking Peptide Cat #: BLP-CC005

Size: 40 µg

Anti-CACNA1G (CaV3.1) Antibody Cat #: ACC-021

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide MDEEEDGAGAEESGQPRSFTQL(C), corresponding to amino acid residues 1-22 of rat CACNA1G (Accession O54898). Intracellular, N-terminus.
Homology
Mouse - identical; human - 20/22 amino acid residues identical.

CACNA1G/Cav3.1 Blocking Peptide Cat #: BLP-CC021

Size: 40 µg

Anti-CaV3.2 (CACNA1H) Antibody Cat #: ACC-025

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide CHVEGPQERARVAHS, corresponding to amino acid residues 581-595 of rat CaV3.2 (Accession number Q9EQ60). Intracellular loop between domains D1 and D2.
Homology
Mouse, bovine and canis - 14/15 amino acid residues identical; human - 13/15 amino acid residues identical.

Cav3.2/CACNA1H Blocking Peptide Cat #: BLP-CC025

Size: 40 µg

Anti-Ryanodine Receptor 2 Antibody Cat #: ARR-002

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide CAGESMSPGQGRNN, corresponding to amino acid residues 1489-1502 of human RyR2 (Accession Q92736). Intracellular, N-terminus.
Homology
Rat, mouse - identical.

Ryanodine Receptor 2 Blocking Peptide Cat #: BLP-RR002

Size: 40 µg

Anti-KCNQ1 Antibody Cat #: APC-022

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
Peptide (C)TYEQLTVPRRGPDEGS, corresponding to amino acid residues 661-676 of human KCNQ1 (Accession P51787). Intracellular, C-terminus.
Homology
Rat, mouse - 14/16 amino acid residues identical.

KCNQ1 Blocking Peptide Cat #: BLP-PC022

Size: 40 µg

Anti-KCNH2 (HERG) Antibody Cat #: APC-062

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IC, IF, IH, IP, WB Reactivity: H, M, R
Immunogen
GST fusion protein with the sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQPLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human KV11.1 (HERG) (Accession Q12809). Intracellular, C-terminus.
Homology
Rabbit - identical; dog - 51/54 amino acid residues identical; mouse, rat - 50/54 amino acid residues identical.

KCNH2/HERG Blocking Peptide Cat #: BLP-PC062

Size: 0.12 mg

Anti-NCX1 (SLC8A1) Antibody Cat #: ANX-011

Size: 50 µl Host: Rabbit Type: Polyclonal Application: IF, IH, WB Reactivity: H, M, R
Immunogen
Peptide (C)EVDERDQDDEEAR, corresponding to amino acid residues 308-320 of rat NCX1 (Accession Q01728). 3rd intracellular loop.
Homology
Human, mouse - identical.

NCX1/SLC8A1 Blocking Peptide Cat #: BLP-NX011

Size: 40 µg

Antibody Storage & Reconstitution Instructions

Storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Reconstitution

Add deionized water, depending on the sample size.

Storage after reconstitution

The reconstituted solution can be stored at 4°C for up to 2 weeks. For longer periods, small aliquots should be stored at -20°C or below.
Avoid multiple freezing and thawing. The further dilutions should be made using a carrier protein such as BSA (1%). Centrifuge all antibody preparations before use (10000 × g 5 min).

Control antigen storage before reconstitution

Lyophilized powder can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Control antigen reconstitution

100 μl water.

Control antigen storage after reconstitution

-20ºC.

Preadsorption control

1 μg peptide per 1 μg antibody.

For research purposes only, not for human use