Overview
Cat #:
STP-050
Alternative Name Beta/mu-theraphotoxin-Pe1b, Beta/mu-TRTX-Pe1b, β/μ-theraphotoxin-Pe1b
Lyophilized Powder yes
Origin Phormingochilus everetti (Malaysian purple earth tiger tarantula)
Source Synthetic
MW: 3975.4 Da
Purity: >98% (HPLC)
Form Lyophilized Powder
Effective concentration 50-500 nM
Sequence ECRYWLGGCSKTGDCCEHLSCSPKWHWCVWDGTF-OH
Modifications Disulfide bonds: Cys2-Cys16, Cys9-Cys21, Cys15-Cys28
Molecular formula C175H237N47O49S6
Activity Blocks several voltage-gated sodium channels with most potent activity on Nav1.71.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Soluble in water. Centrifuge all products before use (10000 x g, 5 min). Avoid multiple freezing and thawing.
Storage of solutions Store at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C.
Scientific background β/μ-theraphotoxin-Pe1b (Pe1b) is a 34 amino acid peptidyl toxin isolated from the venom of the arboreal tarantula Phormingochilus everetti1. Pe1b is a voltage-gated sodium (Nav) channel inhibitor, and it has the greatest inhibitory activity against Nav1.7. Pe1b contains three disulfide bonds that form an inhibitory cysteine-knot (ICK) architectural motif. Its ICK motif belonging to the Nav-targeting spider toxin (NaSpTx) family 2, which contains the most members amongst the 12 sodium channel toxin families (NaSpTx1- NaSpTx12)1,2.
Pe1b is highly similar to Protoxin-1 (ProTx-I), which is also an inhibitor of Nav1.7. The C-terminus of both toxins interact with Nav1.71.
Nav channels are involved in a wide array of physiological processes. In particular, Nav1.7 plays a critical role in the generation and conduction of action potentials. It is also active in pain sensing nerves. Thus, Pe1b may be an important tool for the study of pain, pain treatment, and the development of analgesics.
Target Voltage-gated Na+ channels
Lyophilized Powder
For research purposes only, not for human use
Last Update: 07/05/2024
