Overview
Phrixotoxin-2 (#STP-710) is a highly pure, synthetic, and biologically active peptide toxin.
Alternative Name κ-theraphotoxin-Ps1b, κ-TRTX-Ps1b, PaTX2, Kappa-theraphotoxin-Ps1b
Structure
For research purposes only, not for human use
Applications
Citations (23)
Citations
Powered by BiozProduct citations
- Meneses, D. et al. (2016) Neural Plast. 2016, 8782518.
- Subramaniam, M. et al. (2014) J. Neurosci. 34, 13586.
Specifications
Properties
Technical Specifications
Origin Synthetic peptide
MW 3922 Da
Sequence YCQKWMWTCDEERKCCEGLVCRLWCKRIINM-NH2
Modifications Disulfide bonds between Cys2-Cys16, Cys9-Cys21, and Cys15-Cys25
Met31 - C-terminal methionine amide
Met31 - C-terminal methionine amide
Peptide Content 100%
Purity >99% (HPLC)
Molecular formula C169H259N49O43S8
CAS No. 221889-63-0
Accession number P61231
Biological Activity
Target KV4 channels
Effective concentration 100-500 nM
Activity Phrixotoxin-2 specifically and reversibly blocks KV4.21.
Solubility and Storage
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10,000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Scientific Background
References
Scientific background Phrixotoxin-2 is a natural peptide isolated from the Phrixotrichus auratus Tarantula venom. It blocks specifically and reversibly KV4.2 and KV4.3 channels.1 These channels are probably the molecular counterparts of the A-type current (Ito1) in the heart. Cloned KV4.2 and KV4.3 channels heterologously expressed in COS cell were blocked with IC50 of 34 and 71 nM of Phrixotoxin-2 respectively1.
References
- Diochot, S. et al. (1999) Br. J. Pharmacol. 126, 251.
Last Update: 08/01/2025
