Overview
Type: GST fusion protein
Form: Lyophilized powder
PSD-93 Blocking Peptide (#BLP-PZ002) is the original antigen used for immunization during Anti-PSD-93 Antibody (#APZ-002) generation. The blocking peptide binds and ‘blocks’ Anti-PSD-93 primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.
Applications: wb, ihc
For research purposes only. not for human use
Applications
Demonstration of Pre-adsorption control
Western blot analysis of rat brain membranes:1. Anti-PSD-93 Antibody (#APZ-002), (1:1000).
2. Anti-PSD-93 Antibody, preincubated with PSD-93 Blocking Peptide (#BLP-PZ002).- Rat brain sections.
Properties
Sequence
- GST fusion protein with the sequence VEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPY, corresponding to amino acid residues 336-379 of rat Chapsyn-110 (Accession Q63622).
Accession (Uniprot) Number Q63622
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 μl PBS.
Concentration After Reconstitution 0.4 mg/ml.
Storage After Reconstitution -20°C.
Antigen Preadsorption Control 3 μg fusion protein per 1 μg antibody.
Standard Quality Control Of Each Lot Western blot analysis.
