Certificate of Analysis

Pterinotoxin-1

Name: Pterinotoxin-1
Brand: Alomone Labs
SKU: STT-100

β-Theraphotoxin-Pm1a, β-TRTX-Pm1a, Peptide A

A Novel Blocker of Na_V1.3, Na_V1.7, and Na_V1.8 Voltage-Gated Na⁺ Channels

Back to product page SDS

Overview

Cat #: STT-100

Alternative Name β-Theraphotoxin-Pm1a, β-TRTX-Pm1a, Peptide A

Lyophilized Powder yes

Origin Synthetic peptide

MW: 3970 Da

Purity: >98% (HPLC)

Effective concentration 2-5 µM.

Sequence DDCLGMFSSCDPDNDKCCEGRKCNRKDKWCKYVL.

Modifications Disulfide bonds between Cys³-Cys¹⁸, Cys¹⁰-Cys²³, Cys¹⁷-Cys³⁰. Leu³⁴ – C-terminal amidation.

Structure

Activity Pterinotoxin-1 inhibits rat voltage-gated Na⁺ channels Na_V1.3, Na_V1.7 and Na_V1.8.

Accession number B3EWN0.

Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Solubility 20 mM ammonium acetate, pH =6. Centrifuge all product preparations before use (10000 x g 5 min).

Storage of solutions Up to two weeks at 4°C or three months at -20°C.

Our bioassay

Alomone Labs Pterinotoxin-1 inhibits rat Na_V1.3 and Na_V1.8 channels heterologously expressed in HEK and ND7-23 cells, respectively.
A. Dose response of Na_V channels inhibition by Pterinotoxin-1 (#STT-100). The inhibition was measured in 3-5 cells for each dose in rat Na_V1.3 channels expressed in HEK cells and 3-5 cells for rat Na_V1.8 expressed in ND7-23 cells (in the presence of 600 nM Tetrodotoxin citrate (#T-550)). B. Example of superimposed current traces of rat Na_V1.3 channel activity before and during application of 2 µM of Pterinotoxin-1. Holding potential was -100 mV and currents were stimulated every 10 seconds by a voltage ramp of 40 msec from holding potential to + 60 mV. C. Example of superimposed current traces of rat Na_V1.8 channel activity before and during application of 2 µM of Pterinotoxin-1 (both in the presence of 600 nM Tetrodotoxin (with citrate)). The same voltage protocol was used as in graph B.

Scientific background

Pterinotoxin-1 is isolated from the Pterinochilus murinus (Usambara) spider venom and is a synthetic version of the peptide¹.

Pterinotoxin-1 inhibits voltage-gated rat Na_V1.3, Na_V1.7 and Na_V1.8 Na⁺ channels.

Voltage-gated Na⁺ channels (VGSC, Na_V) play a critical role in excitability of nociceptors (pain-sensing neurons). The peripheral-specific Na⁺ channels Na_V1.7, Na_V1.8 and Na_V1.9 are particularly important in the pathophysiology of different pain syndromes and, hence, thought to be potential targets for pain therapeutics^2-3.

The expression and functional properties of Na_V channels in peripheral sensory neurons can be dynamically regulated following axonal injury or peripheral inflammation⁴.

Pterinotoxin-1 shows high homology to Phrixotoxin-3 (#STP-720) (58%), Huwentoxin-IV (#STH-100) (50%) and Ceratotoxin-2 (#STC-100) (66%).

Target Na_V channels

Peptide Content: 100%

Lyophilized Powder

For research purposes only, not for human use

Last Update: 07/05/2024

Specifications

Citations

Applications

Scientific Background

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.

Reagent Rewards

Not sure whether the product fits your experimental setup?

Try it first!

Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Navigation

Order Summary