Certificate of Analysis

Pterinotoxin-2

Name: Pterinotoxin-2
Brand: Alomone Labs
SKU: STT-150

β/κ-Theraphotoxin-Pm2a, β/κ-TRTX-Pm2a, Peptide B

A Blocker of Na_V1.3 and Na_V1.7 Na⁺ Channels

Back to product page SDS

Overview

Cat #: STT-150

Alternative Name β/κ-Theraphotoxin-Pm2a, β/κ-TRTX-Pm2a, Peptide B

Lyophilized Powder yes

Origin Synthetic peptide

MW: 3637 Da

Purity: >98% (HPLC)

Effective concentration 0.5-1 µM.

Sequence YCQEFLWTCDEERKCCGDMVCRLWCKKRL-NH₂

Modifications Disulfide bonds between Cys²-Cys¹⁶, Cys⁹-Cys²¹, Cys¹⁵-Cys²⁵. Leu²⁹ – C-terminal amidation.

Structure

Molecular formula C₁₅₆H₂₃₇N₄₅O₄₂S₇

Activity Pterinotoxin-2 inhibits voltage-gated Na⁺ Na_V1.3 and Na_V1.7 channels¹.

References-Activity

Meir, A. et al. (2011). Novel peptides isolated from spider venom, and uses thereof. U.S. Patent Application Publication # US 2011/0065647 A1.

Accession number B3EWN1.

Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Solubility Soluble in water. Centrifuge all product preparations before use (10000 x g 5 min).

Storage of solutions Up to two weeks at 4°C or three months at -20°C.

Our bioassay

Alomone Labs Pterinotoxin-2 inhibits rNav1.3 and hNa_V1.7 channels heterologously expressed in HEK293 cells.
A. Dose-response of Na_Vchannels inhibition by Pterinotoxin-2 (#STT-150). The inhibition was measured in 3-5 cells for each dose in rat Nav1.3 channels expressed in HEK cells (open circles) and 3-5 cells for human Na_V1.7 expressed in HEK cells (filled circles). B. Example of superimposed current traces of rat Na_V1.3 channel activity before (black) and during (green) application of the indicated concentration of 0.5 µM Pterinotoxin-2. Holding potential was -100 mV and currents were stimulated every 10 seconds by a voltage ramp of 40 msec from holding potential to +60 mV.

Scientific background

Pterinotoxin-2 is isolated from the Pterinochilus murinus (Usambara) spider venom and is a synthetic version of the peptide¹.

Pterinotoxin-2 inhibits voltage-gated rat Na_V1.3 and Na_V1.7 Na⁺ channels.

Voltage-gated sodium channels (VGSC, Na_V) play a critical role in excitability of nociceptors (pain-sensing neurons). The peripheral-specific sodium channels Na_V1.7, Na_V1.8 and Na_V1.9 are particularly important in the pathophysiology of different pain syndromes and hence, thought to be potential targets for pain therapeutics^2,3.

The expression and functional properties of Na_V channels in peripheral sensory neurons can be dynamically regulated following axonal injury or peripheral inflammation⁴.

Pterinotoxin-2 shows high homology to ProTx-II (#STP-100) (75%), Phrixotoxin-2 (#STP-710) (76%) and Phrixotoxin-1 (#STP-700) (70%).

Target Na_V1.3, Na_V1.7 Na⁺ channels

Peptide Content: 100%

Lyophilized Powder

For research purposes only, not for human use

Last Update: 07/05/2024

Specifications

Citations

Applications

Scientific Background

Shipping and Ordering Information

Free International Shipping

Products are lyophilized and ship at room temperature - FREE OF CHARGE.

We ship worldwide within 24 hours of our next business day.

For more country-specific shipping and contact information see Ordering & Shipping.

Reagent Rewards

Not sure whether the product fits your experimental setup?

Try it first!

Alomone Guarantee

We offer 100% guarantee on all our products. If our products do not perform as stated, please contact our technical support staff.

Alomone Guarantee information

Navigation

Order Summary