Overview
Type: GST fusion protein
Form: Lyophilized powder
SAP102 Blocking Peptide (#BLP-PZ003) is the original antigen used for immunization during Anti-SAP102 Antibody (#APZ-003) generation. The blocking peptide binds and ‘blocks’ Anti-SAP102 primary antibody, this makes it a good negative reagent control to help confirm antibody specificity in western blot and immunohistochemistry applications. This control is also often called a pre-adsorption control.
Applications: wb, ihc
For research purposes only. not for human use
Applications
Demonstration of Pre-adsorption control
Western blot analysis of rat brain membranes:1. Anti-SAP102 Antibody (#APZ-003), (1:400).
2. Anti-SAP102 Antibody, preincubated with the control fusion protein antigen.- Rat brain sections.
Properties
Sequence
- GST fusion protein with the sequence KSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD, corresponding to amino acid residues 93-124 of human SAP102 (Accession Q92796).
Accession (Uniprot) Number Q92796
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 μl PBS.
Storage After Reconstitution -20°C.
Antigen Preadsorption Control 1 μg fusion protein per 1 μg antibody.
Standard Quality Control Of Each Lot Western blot analysis.
