Cat #: BLP-PZ003
Size: 50 µg
Type: GST fusion protein
Form: Lyophilized powder
Applications: wb, ihc
Application key:
WB- Western blot, IHC- Immunohistochemistry
For research purposes only. not for human use
Properties
Sequence
- GST fusion protein with the sequence KSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD, corresponding to amino acid residues 93-124 of human SAP102 (Accession Q92796).
Accession (Uniprot) Number Q92796
Peptide Confirmation Confirmed by DNA sequence and SDSPAGE.
Purity >95% (SDS-PAGE)
Storage Before Reconstitution Lyophilized powder can be stored intact at room temperature for two weeks. For longer periods, it should be stored at -20°C.
Reconstitution 100 μl PBS.
Storage After Reconstitution -20°C.
Antigen Preadsorption Control 1 μg fusion protein per 1 μg antibody.
Standard Quality Control Of Each Lot Western blot analysis.
Applications
Demonstration of Pre-adsorption control
- Western blot analysis of rat brain membranes:1. Anti-SAP102 Antibody (#APZ-003), (1:400).
2. Anti-SAP102 Antibody, preincubated with the control fusion protein antigen. - Rat brain sections.
Last update: 08/01/2025