Overview
Cat #:
STS-500
Alternative Name Potassium channel toxin alpha-KTx 6.13, SPX, α-KTx6.13
Lyophilized Powder yes
Origin Synthetic peptide
MW: 3701.2 Da
Purity: >98% (HPLC)
Form Lyophilized powder.
Effective concentration 2-100 nM.
Sequence IRCSGSRDCYSPCMKQTGCPNAKCINKSCKCYGC.
Modifications Disulfide bonds between Cys3-Cys24, Cys9-Cys29, Cys13-Cys31 and Cys19-Cys34. Cys34 – C-terminal amidation.
Molecular formula C147H236N48O46S9.
Activity Spinoxin is a potent blocker of KV1.2 and KV1.3 channels1.
References-Activity
- Peigneur, S. et al. (2016) Biochemistry. 55, 2927.
Accession number P84094.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
Storage of solutions Up to two weeks at 4°C or three months at -20°C.
Our bioassay
- Alomone Labs Spinoxin blocks KV1.2 channels expressed in Xenopus oocytes.A. Representative time course of Spinoxin (#STS-500) inhibition of KV1.2 current. Membrane potential was held at -100 mV, current was elicited by a 100 ms voltage ramp to +50 mV every 10 sec, and reversibly inhibited by application of 0.1 nM and 1 nM Spinoxin (indicated by bars). B. Superimposed traces of KV1.2 current after the application of control, 0.1 nM and 1 nM Spinoxin (as indicated). Taken from the recording in A.
Scientific background
Spinoxin (SPX, α-KTx6.13) is a 34-residue peptide toxin originally isolated from the scorpion Heterometrus spinifer venom. Spinoxin is a potent KV1.3 channel blocker displaying IC50 values of 63 nM. It also has high affinity towards KV1.2 channels1,2.
K+ ion channels play an important role in the modulation of Ca2+ signaling by controlling the membrane potential. These channels are considered to be very important targets in the diagnostics and therapy in several autoimmune disorders and cancers1.
Target KV1.2, KV1.3 channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 08/01/2025
Specifications
Citations
Citations