Overview
Cat #:
STS-350
Alternative Name κ-Theraphotoxin-Sc1a, κ-TRTX-Sc1a, ScTx1
Lyophilized Powder yes
Origin Synthetic peptide
MW: 3792 Da
Purity: >98% (HPLC)
Effective concentration 1.2-670 nM
Sequence DCTRMFGACRRDSDCCPHLGCKPTSKYCAWDGTI
Modifications Disulfide bonds between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys28, Ile34 - C-terminal amidation
Molecular formula C156H237N49O48S7
Activity Stromatoxin-1 is a potent inhibitor of voltage-gated K+ channels. It inhibits delayed KV2.1, KV2.1/9.3, KV2.2, and transient KV4.2 channels1,2.
References-Activity
- Escoubas, P. et al. (2002) Mol. pharmacol. 62, 48.
- Shiau, Y.S. et al. (2003) Chem. Res. Toxiol. 16, 1217.
Shipping and storage Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.
Solubility Any aqueous buffer. Centrifuge all products preparations before use (1000 X g 5 min).
Storage of solutions Up to one week at 4°C or three months at -20°C.
Our bioassay
- Alomone Labs Stromatoxin-1 inhibits KV2.1 channels heterologously expressed in Xenopus oocytes.Left: Time course of KV2.1 current amplitude before and during application of 100 nM Stromatoxin-1 (#STS-350). The periods of Stromatoxin-1 perfusion is indicated by the horizontal bar.
Right: Stromatoxin-1 dose-dependent inhibition of KV2.1 current amplitude.
Scientific background
Stromatoxin-1 is a 34 amino acid peptidyl toxin originally isolated from Stromatopelma calceatum tarantula1. Structurally, Stromatoxin-1 belongs to the scaffold of structural inhibitor cysteine knot peptide family, which were shown to function as gating modifiers2.
Stromatoxin-1 selectively inhibits KV2.1, KV2.1/9.3, and KV4.2 channel currents (IC50 of 12.7 nM, 7.2 nM and 1.2 nM respectively), and is the first high-affinity voltage gating modifier inhibitor of the KV2.2 channel subtype (IC50, 21.4 nM) to be discovered1.
Target Various KV channels
Peptide Content: 100%
Lyophilized Powder
For research purposes only, not for human use
Last Update: 08/01/2025
Specifications
Citations
Citations